| Clone Name | rbaal6g21 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | VASA_DROME (P09052) ATP-dependent RNA helicase vasa (EC 3.6.1.-)... | 29 | 2.9 | 2 | VIPR2_MOUSE (P41588) Vasoactive intestinal polypeptide receptor ... | 28 | 8.4 |
|---|
>VASA_DROME (P09052) ATP-dependent RNA helicase vasa (EC 3.6.1.-) (Antigen| Mab46F11) Length = 661 Score = 29.3 bits (64), Expect = 2.9 Identities = 18/44 (40%), Positives = 25/44 (56%), Gaps = 3/44 (6%) Frame = +1 Query: 100 EHDRADEQPSRDGREQRSND---RLDRYEQGGVVRHEDDRGYGG 222 E++ DE+ R RE+R + RLDR E+GG +RG GG Sbjct: 134 ENEDGDERRGRLDREERGGERRGRLDREERGG---ERGERGDGG 174
>VIPR2_MOUSE (P41588) Vasoactive intestinal polypeptide receptor 2 precursor| (VIP-R-2) (Pituitary adenylate cyclase-activating polypeptide type III receptor) (PACAP type III receptor) (PACAP-R-3) Length = 437 Score = 27.7 bits (60), Expect = 8.4 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = -3 Query: 166 PDGRCYVVRGRLCWAVRRLCRARWTAGRLT 77 P RC++ + W + +C WTA RL+ Sbjct: 235 PPSRCFLAYLLIGWGIPSVCIGAWTATRLS 264 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,719,126 Number of Sequences: 219361 Number of extensions: 395168 Number of successful extensions: 1113 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1066 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1112 length of database: 80,573,946 effective HSP length: 51 effective length of database: 69,386,535 effective search space used: 1665276840 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)