| Clone Name | rbaal10g20 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MUC5B_HUMAN (Q9HC84) Mucin-5B precursor (Mucin 5 subtype B, trac... | 30 | 1.3 | 2 | INVS_BRARE (Q8UVC1) Inversin | 30 | 1.7 | 3 | CO4A4_HUMAN (P53420) Collagen alpha-4(IV) chain precursor | 30 | 1.7 | 4 | RL4_CORDI (P61062) 50S ribosomal protein L4 | 28 | 6.3 | 5 | RNP4_AERPE (Q9YD20) Ribonuclease P protein component 4 (EC 3.1.2... | 28 | 6.3 | 6 | RL4_FUSNN (Q8RIF6) 50S ribosomal protein L4 | 28 | 6.3 | 7 | RL4_CORGL (Q8NT08) 50S ribosomal protein L4 | 28 | 6.3 | 8 | RL4_COREF (Q8FS79) 50S ribosomal protein L4 | 28 | 6.3 | 9 | RESIL_DROME (Q9V7U0) Pro-resilin precursor | 28 | 8.2 |
|---|
>MUC5B_HUMAN (Q9HC84) Mucin-5B precursor (Mucin 5 subtype B, tracheobronchial)| (High molecular weight salivary mucin MG1) (Sublingual gland mucin) Length = 5703 Score = 30.4 bits (67), Expect = 1.3 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = -2 Query: 123 CPLGLYDKASCPSYSPHGLSPWRVNPWGXPC 31 CPL C Y+PHG W P G PC Sbjct: 1152 CPL------FCDFYNPHGGCEWHYQPCGAPC 1176
>INVS_BRARE (Q8UVC1) Inversin| Length = 1021 Score = 30.0 bits (66), Expect = 1.7 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = +3 Query: 69 TRVGYNLGRRPYRKGPRGIAPGGRLKAHHMAGRLTKGNVETLPRPR 206 T + N G R+ P G + G K H + G++ET P P+ Sbjct: 707 TGISLNCGSANERRSPAGSSRPGSAKPVHTGTHVAPGHMETTPTPK 752
>CO4A4_HUMAN (P53420) Collagen alpha-4(IV) chain precursor| Length = 1690 Score = 30.0 bits (66), Expect = 1.7 Identities = 16/39 (41%), Positives = 18/39 (46%), Gaps = 8/39 (20%) Frame = +2 Query: 110 RPKGHRTRRPAQGP--------SHGRPAHEGKCGDSPSP 202 R KGH+ R GP SHGR H G+ GD P Sbjct: 563 RVKGHKGERGPDGPPGFPGQPGSHGRDGHAGEKGDPGPP 601
>RL4_CORDI (P61062) 50S ribosomal protein L4| Length = 217 Score = 28.1 bits (61), Expect = 6.3 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +3 Query: 90 GRRPYRKGPRGIAPGGRLKAHHMAGRLTKGNVETLPRPR 206 GR+P+R+ G A G ++A H G G + P+PR Sbjct: 63 GRKPFRQKGTGRARQGSIRAPHFTG----GGISHGPKPR 97
>RNP4_AERPE (Q9YD20) Ribonuclease P protein component 4 (EC 3.1.26.5) (RNase P| component 4) Length = 103 Score = 28.1 bits (61), Expect = 6.3 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = +3 Query: 93 RRPYRKGPRGIAPGGRLKAHHMAGRLTKGNVE 188 R PYRKGPRG AP A + +G G E Sbjct: 44 RYPYRKGPRGGAPISPPAAEYGSGGRDSGERE 75
>RL4_FUSNN (Q8RIF6) 50S ribosomal protein L4| Length = 209 Score = 28.1 bits (61), Expect = 6.3 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +3 Query: 90 GRRPYRKGPRGIAPGGRLKAHHMAGRLTKGNVETLPRPR 206 GR+P+++ G A G ++A HM G G V P PR Sbjct: 61 GRKPFKQKGTGRARQGTIRAPHMVG----GGVTFGPHPR 95
>RL4_CORGL (Q8NT08) 50S ribosomal protein L4| Length = 218 Score = 28.1 bits (61), Expect = 6.3 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +3 Query: 90 GRRPYRKGPRGIAPGGRLKAHHMAGRLTKGNVETLPRPR 206 GR+P+R+ G A G ++A H G G + P+PR Sbjct: 63 GRKPFRQKGTGRARQGSIRAPHFTG----GGISHGPKPR 97
>RL4_COREF (Q8FS79) 50S ribosomal protein L4| Length = 218 Score = 28.1 bits (61), Expect = 6.3 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = +3 Query: 90 GRRPYRKGPRGIAPGGRLKAHHMAGRLTKGNVETLPRPR 206 GR+P+R+ G A G ++A H G G + P+PR Sbjct: 63 GRKPFRQKGTGRARQGSIRAPHFTG----GGISHGPKPR 97
>RESIL_DROME (Q9V7U0) Pro-resilin precursor| Length = 620 Score = 27.7 bits (60), Expect = 8.2 Identities = 21/58 (36%), Positives = 26/58 (44%), Gaps = 1/58 (1%) Frame = +2 Query: 62 GDNPCGL*LGQEALS*-RPKGHRTRRPAQGPSHGRPAHEGKCGDSPSPKIVGSRIRHG 232 G P G LG++ S RP G A G S+GRP G G I+G R+ G Sbjct: 491 GGRPGGQDLGRDGYSGGRPGGQDLG--ASGYSNGRPGGNGNGGSDGGRVIIGGRVIGG 546 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,214,595 Number of Sequences: 219361 Number of extensions: 810646 Number of successful extensions: 2366 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 2296 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2359 length of database: 80,573,946 effective HSP length: 57 effective length of database: 68,070,369 effective search space used: 1633688856 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)