| Clone Name | rbaal10g09 |
|---|---|
| Clone Library Name | barley_pub |
>CRIS2_MOUSE (P16563) Cysteine-rich secretory protein 2 precursor (CRISP-2)| (Testis-specific protein TPX-1) Length = 243 Score = 30.8 bits (68), Expect = 3.6 Identities = 14/42 (33%), Positives = 21/42 (50%) Frame = -2 Query: 262 CKQPFCEHSCSMRSLVHHAWVLKIPTCCTAELNKTECKISDL 137 C+ C +SC L+ + LK C EL KT+C+ + L Sbjct: 196 CENGLCTNSCDFEDLLSNCESLKTSAGCKHELLKTKCQATCL 237
>PGBM_HUMAN (P98160) Basement membrane-specific heparan sulfate proteoglycan core| protein precursor (HSPG) (Perlecan) (PLC) Length = 4391 Score = 30.0 bits (66), Expect = 6.1 Identities = 17/52 (32%), Positives = 28/52 (53%) Frame = +3 Query: 324 ISTYAVTGAPSQEQLPATRRKAHRLTLVIMCRPLSNLHVLYCLEARSSPLQD 479 ++T +++GA S LPA H L L + +PL+ VL +S P++D Sbjct: 3927 VTTPSLSGAGSYLALPALTNTHHELRLDVEFKPLAPDGVLLFSGGKSGPVED 3978
>POLG_TMEVG (P08545) Genome polyprotein [Contains: Coat protein VP4 (P1A); Coat| protein VP2 (P1B); Coat protein VP3 (P1C); Coat protein VP1 (P1D); Picornain 2A (EC 3.4.22.29) (Core protein P2A); Core protein P2B; Core protein P2C; Core protein P3A; Genome Length = 2303 Score = 30.0 bits (66), Expect = 6.1 Identities = 17/49 (34%), Positives = 27/49 (55%) Frame = -1 Query: 593 LNRTEYLVPSV*YLNYYDFSGLVPLIFITTVVIFTLCSILKWRRSCLKT 447 L T+++ SV YL+ DF+ V L +T V + T S+ W +S L + Sbjct: 1127 LKTTKFIAASVLYLHNPDFTTTVCLSLMTGVDLLTNDSVFDWLKSKLSS 1175
>KR102_HUMAN (P60368) Keratin-associated protein 10-2 (Keratin-associated| protein 10.2) (High sulfur keratin-associated protein 10.2) (Keratin-associated protein 18-2) (Keratin-associated protein 18.2) Length = 255 Score = 30.0 bits (66), Expect = 6.1 Identities = 15/52 (28%), Positives = 22/52 (42%) Frame = -2 Query: 262 CKQPFCEHSCSMRSLVHHAWVLKIPTCCTAELNKTECKISDLGCCSTYEHSC 107 C+Q C+ +C S + ++P CC A C S CC + SC Sbjct: 121 CQQSSCQPACCASSSCQQS--CRVPVCCKAVCCVPTCSESSSSCCQ--QSSC 168
>BRD3_MOUSE (Q8K2F0) Bromodomain-containing protein 3 (Bromodomain-containing| FSH-like protein FSRG2) Length = 726 Score = 30.0 bits (66), Expect = 6.1 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = -1 Query: 440 DMEIGERPAHDNKGQPMSLAPGRWELFLRWSTSDRICRYSWPVFLPV 300 D+E GE P H K +S + LR S + Y+WP + PV Sbjct: 291 DLEDGEVPQHAGKKGKLSEHLRHCDSILREMLSKKHAAYAWPFYKPV 337
>PGBM_MOUSE (Q05793) Basement membrane-specific heparan sulfate proteoglycan core| protein precursor (HSPG) (Perlecan) (PLC) Length = 3707 Score = 29.6 bits (65), Expect = 8.0 Identities = 16/52 (30%), Positives = 27/52 (51%) Frame = +3 Query: 324 ISTYAVTGAPSQEQLPATRRKAHRLTLVIMCRPLSNLHVLYCLEARSSPLQD 479 ++T +++GA S LPA H L L + +PL +L +S P++D Sbjct: 3244 VTTPSMSGAGSYLALPALTNTHHELRLDVEFKPLEPNGILLFSGGKSGPVED 3295
>TGFA_RAT (P01134) Transforming growth factor alpha precursor (TGF-alpha)| (EGF-like TGF) (ETGF) (TGF type 1) Length = 159 Score = 29.6 bits (65), Expect = 8.0 Identities = 23/59 (38%), Positives = 31/59 (52%), Gaps = 3/59 (5%) Frame = -3 Query: 216 CITH-GFLKFR--HAALLS*TRPSVKSVTWAAAVLMSIVAQYSIWSHIITCYLVKSCVV 49 C+ H G++ R HA LL+ S K A V++SIVA + IITC L+ C V Sbjct: 70 CVCHSGYVGVRCEHADLLAVVAASQKKQAITALVVVSIVALAVL---IITCVLIHCCQV 125 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 97,126,818 Number of Sequences: 219361 Number of extensions: 2153274 Number of successful extensions: 5028 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 4813 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5027 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6029593548 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)