| Clone Name | rbaal10b18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FKBP9_MOUSE (Q9Z247) FK506-binding protein 9 precursor (EC 5.2.1... | 30 | 7.2 | 2 | BCSA_SALTY (Q93IN2) Cellulose synthase catalytic subunit [UDP-fo... | 30 | 7.2 | 3 | BCSA_SALTI (Q8Z291) Cellulose synthase catalytic subunit [UDP-fo... | 30 | 7.2 | 4 | XDH_BOVIN (P80457) Xanthine dehydrogenase/oxidase [Includes: Xan... | 29 | 9.5 |
|---|
>FKBP9_MOUSE (Q9Z247) FK506-binding protein 9 precursor (EC 5.2.1.8)| (Peptidyl-prolyl cis-trans isomerase) (PPIase) (Rotamase) (FKBP65RS) Length = 570 Score = 29.6 bits (65), Expect = 7.2 Identities = 20/59 (33%), Positives = 31/59 (52%) Frame = -2 Query: 184 VISPG*PLHMPVILASLWSLNPSIH*YTVV*ISPTSCTRGQLTVKLTGNFIQIYHVNIT 8 VI P LH V+L +W+ +H T P SC R T++++ +F++ YH N T Sbjct: 125 VIPPNSVLHFDVLLVDIWNSEDQVHIQTY--FKPPSCPR---TIQVS-DFVR-YHYNGT 176
>BCSA_SALTY (Q93IN2) Cellulose synthase catalytic subunit [UDP-forming] (EC| 2.4.1.12) Length = 874 Score = 29.6 bits (65), Expect = 7.2 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -3 Query: 498 IMTPGQEGLLENSRGYIRLGQSQGFLALKCFWTVQRW 388 ++ P L E +GY R G S AL C WT+ W Sbjct: 9 LIPPVSARLSERYQGYRRHGASPFSAALGCLWTILAW 45
>BCSA_SALTI (Q8Z291) Cellulose synthase catalytic subunit [UDP-forming] (EC| 2.4.1.12) Length = 874 Score = 29.6 bits (65), Expect = 7.2 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = -3 Query: 498 IMTPGQEGLLENSRGYIRLGQSQGFLALKCFWTVQRW 388 ++ P L E +GY R G S AL C WT+ W Sbjct: 9 LIPPVSARLSERYQGYRRHGASPFSAALGCLWTILAW 45
>XDH_BOVIN (P80457) Xanthine dehydrogenase/oxidase [Includes: Xanthine| dehydrogenase (EC 1.17.1.4) (XD); Xanthine oxidase (EC 1.17.3.2) (XO) (Xanthine oxidoreductase)] Length = 1331 Score = 29.3 bits (64), Expect = 9.5 Identities = 16/49 (32%), Positives = 26/49 (53%), Gaps = 2/49 (4%) Frame = +1 Query: 274 QGLETWLHDGSI*YERCCSGHKHSPPVARDLR--HILILTPSLDSPEAF 414 QG T+ +G CC G+ ++P + + H + L+PSL +PE F Sbjct: 157 QGFRTFAKNGG-----CCGGNGNNPNCCMNQKKDHTVTLSPSLFNPEEF 200 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 87,459,594 Number of Sequences: 219361 Number of extensions: 1719618 Number of successful extensions: 3632 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3584 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3632 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5481822624 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)