| Clone Name | rbaal10a21 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | Y5224_ARATH (Q94EG6) Protein At5g02240 | 40 | 0.008 | 2 | Y2766_ARATH (O80934) Protein At2g37660, chloroplast precursor | 38 | 0.025 |
|---|
>Y5224_ARATH (Q94EG6) Protein At5g02240| Length = 253 Score = 39.7 bits (91), Expect = 0.008 Identities = 25/97 (25%), Positives = 45/97 (46%), Gaps = 5/97 (5%) Frame = -1 Query: 674 IRESGVPYSIVRPCALTEEPAGA-DLIFEQGDNI----TGKISREEVARICVAALASPSA 510 + +SG PY+I+R L ++ G +L+ + D + T + R +VA +C+ AL A Sbjct: 162 LADSGTPYTIIRAGGLLDKEGGVRELLVGKDDELLQTDTKTVPRADVAEVCIQALLFEEA 221 Query: 509 VGKTFEVKSTVPFSEPFVIDPSNPPPEKDYEVYFKEL 399 K F++ S P KD++ F ++ Sbjct: 222 KNKAFDLGSK---------PEGTSTPTKDFKALFSQV 249
>Y2766_ARATH (O80934) Protein At2g37660, chloroplast precursor| Length = 325 Score = 38.1 bits (87), Expect = 0.025 Identities = 26/97 (26%), Positives = 46/97 (47%), Gaps = 5/97 (5%) Frame = -1 Query: 674 IRESGVPYSIVRPCALTEEPAG-ADLIFEQGDNI----TGKISREEVARICVAALASPSA 510 + +SG+PY+I+R L ++ G +L+ + D + T I+R +VA +CV AL A Sbjct: 234 LADSGIPYTIIRAGGLQDKDGGIRELLVGKDDELLETETRTIARADVAEVCVQALQLEEA 293 Query: 509 VGKTFEVKSTVPFSEPFVIDPSNPPPEKDYEVYFKEL 399 K ++ S P KD++ F ++ Sbjct: 294 KFKALDLASK---------PEGTGTPTKDFKALFTQV 321 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,412,807 Number of Sequences: 219361 Number of extensions: 1891702 Number of successful extensions: 4502 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4384 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4502 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6598423128 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)