| Clone Name | rbaal6f20 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SLAP_LACHE (P38059) S-layer protein precursor (Surface layer pro... | 29 | 3.6 | 2 | ARLY_CLOPE (Q8XMJ8) Argininosuccinate lyase (EC 4.3.2.1) (Argino... | 28 | 6.1 | 3 | PURO_METTH (O27099) IMP cyclohydrolase (EC 3.5.4.10) (Inosinicas... | 28 | 6.1 | 4 | Y983_AQUAE (O67109) Hypothetical protein aq_983 | 28 | 7.9 | 5 | ZN337_HUMAN (Q9Y3M9) Zinc finger protein 337 | 28 | 7.9 |
|---|
>SLAP_LACHE (P38059) S-layer protein precursor (Surface layer protein)| Length = 439 Score = 28.9 bits (63), Expect = 3.6 Identities = 16/37 (43%), Positives = 20/37 (54%) Frame = +3 Query: 111 WRFGNEYYGRVLHTGRSHNGQVTFYRITGDHPGSNTK 221 + FG+E G+ + G S N VTF TGD P S K Sbjct: 129 FNFGSENAGKEITIG-SANPNVTFTEKTGDQPASTVK 164
>ARLY_CLOPE (Q8XMJ8) Argininosuccinate lyase (EC 4.3.2.1) (Arginosuccinase)| (ASAL) Length = 466 Score = 28.1 bits (61), Expect = 6.1 Identities = 17/40 (42%), Positives = 20/40 (50%) Frame = +3 Query: 135 GRVLHTGRSHNGQVTFYRITGDHPGSNTKCIRKGVSAVLI 254 G+ LHTGRS N QVT +TK KG +LI Sbjct: 99 GKKLHTGRSRNDQVTL----------DTKLYLKGYIKILI 128
>PURO_METTH (O27099) IMP cyclohydrolase (EC 3.5.4.10) (Inosinicase) (IMP| synthetase) Length = 202 Score = 28.1 bits (61), Expect = 6.1 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +3 Query: 129 YYGRVLHTGRSHNGQVTFYRITGDHPGSNTKCIRKGVSAVL 251 Y GR+L GR+ NG YR++ + T I++ AV+ Sbjct: 2 YLGRILAVGRNSNGSFVAYRVSSRSFPNRTTSIQEERVAVV 42
>Y983_AQUAE (O67109) Hypothetical protein aq_983| Length = 292 Score = 27.7 bits (60), Expect = 7.9 Identities = 10/40 (25%), Positives = 20/40 (50%) Frame = +2 Query: 50 YNQTVSVHQLFGAVAFLVREMAVWK*VLRPSITHRSFAQW 169 Y + S+H ++ +A + + VWK V+ R + +W Sbjct: 223 YRKEKSLHDVYACIAMFKKNLFVWKEVIPVYRKGRKYTEW 262
>ZN337_HUMAN (Q9Y3M9) Zinc finger protein 337| Length = 751 Score = 27.7 bits (60), Expect = 7.9 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = -2 Query: 92 LPHQTTGELRPFGCITCTRRKXEKNSKN 9 L +T E +P+GC C RR +K+S N Sbjct: 477 LHQRTHSEEKPYGCRECGRRFRDKSSYN 504 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,743,382 Number of Sequences: 219361 Number of extensions: 704135 Number of successful extensions: 2013 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1977 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2013 length of database: 80,573,946 effective HSP length: 68 effective length of database: 65,657,398 effective search space used: 1575777552 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)