| Clone Name | rbaal6e17 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PTPA_RABIT (Q28717) Serine/threonine-protein phosphatase 2A regu... | 30 | 6.3 |
|---|
>PTPA_RABIT (Q28717) Serine/threonine-protein phosphatase 2A regulatory subunit| B' (PP2A, subunit B', PR53 isoform) (Phosphotyrosyl phosphatase activator) (PTPA) Length = 323 Score = 30.0 bits (66), Expect = 6.3 Identities = 24/102 (23%), Positives = 44/102 (43%), Gaps = 16/102 (15%) Frame = -3 Query: 377 KWMREGPPLGDKHGRFRRR----------------LGALVHCFTEAALPIVDT*LHHLVG 246 +W+ E PP+ D+ RF + + A+V AA+P V L VG Sbjct: 86 RWIDETPPV-DQPSRFGNKAYRTWYAKLDEEAEGLVAAVVPAHLAAAVPEVAVYLKESVG 144 Query: 245 QQVRIWQKTAHVVSYS*IVSLLQRCQKLQTEDSLVGLLELFS 120 RI T H +++ + L + L+ +D + + ++F+ Sbjct: 145 NSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFN 186 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 98,798,007 Number of Sequences: 219361 Number of extensions: 2108751 Number of successful extensions: 5890 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 5618 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5876 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6257125380 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)