| Clone Name | rbaal6d03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | INX14_CAEEL (O62136) Innexin-14 | 32 | 2.0 | 2 | EXG1_YEAST (P23776) Glucan 1,3-beta-glucosidase I/II precursor (... | 31 | 3.5 | 3 | DNAA_CORDI (Q6NKL7) Chromosomal replication initiator protein dnaA | 30 | 5.9 | 4 | IRPA_SYNP7 (P12608) Iron-regulated protein A precursor | 30 | 5.9 |
|---|
>INX14_CAEEL (O62136) Innexin-14| Length = 434 Score = 31.6 bits (70), Expect = 2.0 Identities = 14/36 (38%), Positives = 21/36 (58%) Frame = +3 Query: 165 NYVQLYERTAYTVDKLGVYFHDHLFFIMAQKLGHSS 272 N + +E+T VD++ Y HDH F A K+G+ S Sbjct: 147 NSEKTFEKTKEKVDRIVNYMHDHFKFRRAHKMGYLS 182
>EXG1_YEAST (P23776) Glucan 1,3-beta-glucosidase I/II precursor (EC 3.2.1.58)| (Exo-1,3-beta-glucanase I/II) (Soluble cell wall protein 6) Length = 448 Score = 30.8 bits (68), Expect = 3.5 Identities = 21/63 (33%), Positives = 32/63 (50%), Gaps = 5/63 (7%) Frame = -3 Query: 588 DNGITIK---LCTF--EDADRMTVRTEDKTFYTEDDFRDFLSRRGWTLLREYSGYRVADT 424 D GI + C + +D + +++ TFY E DF + S +G+ L+R GY T Sbjct: 83 DEGIPVDEYHFCQYLGKDLAKSRLQSHWSTFYQEQDFANIAS-QGFNLVRIPIGYWAFQT 141 Query: 423 LDD 415 LDD Sbjct: 142 LDD 144
>DNAA_CORDI (Q6NKL7) Chromosomal replication initiator protein dnaA| Length = 552 Score = 30.0 bits (66), Expect = 5.9 Identities = 16/53 (30%), Positives = 24/53 (45%), Gaps = 2/53 (3%) Frame = -2 Query: 400 DLPGDALTCRLILHHLPDNGHLYLGYVGFEPKFVLAHCWQENEL--EWPSFWA 248 DLP D ++ HH+P++ H G+ P + E E+PS WA Sbjct: 96 DLPHDVPEQHIVQHHVPEHPHYSPVSQGYPPHYAPEQSEYNTEYSDEYPSGWA 148
>IRPA_SYNP7 (P12608) Iron-regulated protein A precursor| Length = 356 Score = 30.0 bits (66), Expect = 5.9 Identities = 23/74 (31%), Positives = 34/74 (45%) Frame = +1 Query: 241 LSWPKNLAILVRFLANNGQARTWAQNQHTPDIDAHCRANDAGSIDK*AHPLVNRARTKIV 420 LS ++L IL L Q Q + AGS D A+P +N A T+IV Sbjct: 166 LSDRQHLVILATDLTKQAQGLVTRWQQASDQPAYRSVLLSAGSTDS-AYPTLNAAGTEIV 224 Query: 421 QSISDSVATILPEE 462 Q + DS++ + E+ Sbjct: 225 QGLVDSLSEVASEK 238 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 96,028,242 Number of Sequences: 219361 Number of extensions: 2093164 Number of successful extensions: 4522 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4415 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4522 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5824436538 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)