| Clone Name | rbaal5n21 |
|---|---|
| Clone Library Name | barley_pub |
>RNF4_RAT (O88846) RING finger protein 4 (SNURF)| Length = 194 Score = 43.9 bits (102), Expect = 2e-04 Identities = 13/36 (36%), Positives = 24/36 (66%) Frame = -2 Query: 421 GHIFCQKCIKASIQXXKKCPTCRRKLTISNFXRVYL 314 GH+FC +C++ S++ CPTCR+K+ + +Y+ Sbjct: 159 GHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYI 194
>RNF4_MOUSE (Q9QZS2) RING finger protein 4| Length = 194 Score = 43.9 bits (102), Expect = 2e-04 Identities = 13/36 (36%), Positives = 24/36 (66%) Frame = -2 Query: 421 GHIFCQKCIKASIQXXKKCPTCRRKLTISNFXRVYL 314 GH+FC +C++ S++ CPTCR+K+ + +Y+ Sbjct: 159 GHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYI 194
>RNF4_HUMAN (P78317) RING finger protein 4| Length = 190 Score = 43.9 bits (102), Expect = 2e-04 Identities = 13/36 (36%), Positives = 24/36 (66%) Frame = -2 Query: 421 GHIFCQKCIKASIQXXKKCPTCRRKLTISNFXRVYL 314 GH+FC +C++ S++ CPTCR+K+ + +Y+ Sbjct: 155 GHVFCSQCLRDSLKNANTCPTCRKKINHKRYHPIYI 190
>BRE1_CANAL (Q5A4X0) Ubiquitin-protein ligase BRE1 (EC 6.3.2.-)| Length = 681 Score = 35.4 bits (80), Expect = 0.059 Identities = 12/40 (30%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = -2 Query: 430 TIXGHIFCQKCIKASIQX-XKKCPTCRRKLTISNFXRVYL 314 T+ GH+FC KC + + ++CP+C R + ++ ++L Sbjct: 642 TVCGHVFCSKCTQERLAARLRRCPSCNRGFSANDLLSIHL 681
>AMFR2_HUMAN (Q9UKV5) Autocrine motility factor receptor, isoform 2 (EC 6.3.2.-)| (AMF receptor) (gp78) Length = 643 Score = 35.4 bits (80), Expect = 0.059 Identities = 13/34 (38%), Positives = 21/34 (61%) Frame = -2 Query: 421 GHIFCQKCIKASIQXXKKCPTCRRKLTISNFXRV 320 GH+F C+++ ++ CPTCR L I++ RV Sbjct: 357 GHLFHNSCLRSWLEQDTSCPTCRMSLNIADNNRV 390
>RAD18_KLULA (Q6CTZ8) Postreplication repair ubiquitin-protein ligase E3 RAD18| (EC 6.-.-.-) Length = 427 Score = 35.4 bits (80), Expect = 0.059 Identities = 15/36 (41%), Positives = 19/36 (52%) Frame = -2 Query: 421 GHIFCQKCIKASIQXXKKCPTCRRKLTISNFXRVYL 314 GH FC CI+ +Q KCP C LT S + +L Sbjct: 48 GHSFCSICIRKYLQKESKCPLCLSDLTESMLQKEFL 83
>BRE1_YEAST (Q07457) Ubiquitin-protein ligase BRE1 (EC 6.3.2.-) (Brefeldin| A-sensitivity protein 1) Length = 700 Score = 35.4 bits (80), Expect = 0.059 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = -2 Query: 421 GHIFCQKCIKASIQXX-KKCPTCRRKLTISNFXRVYL 314 GH+FC+ C K + +KCPTC + + ++ V+L Sbjct: 664 GHVFCENCCKERLAARMRKCPTCNKAFSSNDLLTVHL 700
>BRE1_CANGA (Q6FWF3) Ubiquitin-protein ligase BRE1 (EC 6.3.2.-)| Length = 693 Score = 35.0 bits (79), Expect = 0.077 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 1/37 (2%) Frame = -2 Query: 421 GHIFCQKCIKASIQXX-KKCPTCRRKLTISNFXRVYL 314 GH+FC+ C K + +KCPTC + + ++ V+L Sbjct: 657 GHVFCEDCCKERLAARMRKCPTCNKPFSSNDLLMVHL 693
>PEX10_PICAN (Q00940) Peroxisome assembly protein 10 (Peroxin-10) (Peroxisome| biogenesis factor 10) (Peroxisome assembly protein PER8) Length = 295 Score = 35.0 bits (79), Expect = 0.077 Identities = 11/26 (42%), Positives = 18/26 (69%) Frame = -2 Query: 421 GHIFCQKCIKASIQXXKKCPTCRRKL 344 GH+FC KC+ ++ ++CP CR K+ Sbjct: 261 GHVFCWKCVLDWVKERQECPLCRAKM 286
>RN141_CHICK (Q5ZM74) RING finger protein 141| Length = 230 Score = 35.0 bits (79), Expect = 0.077 Identities = 13/26 (50%), Positives = 16/26 (61%) Frame = -2 Query: 418 HIFCQKCIKASIQXXKKCPTCRRKLT 341 H FCQKCI + CP CRR++T Sbjct: 171 HSFCQKCIDKWSDRHRSCPVCRRQVT 196
>YB1B_SCHPO (P87176) Hypothetical RING finger protein C3D6.11c in chromosome II| Length = 269 Score = 34.3 bits (77), Expect = 0.13 Identities = 14/29 (48%), Positives = 19/29 (65%), Gaps = 3/29 (10%) Frame = -2 Query: 421 GHIFCQKCIKASI---QXXKKCPTCRRKL 344 GHIFC CI +++ +KCP CRRK+ Sbjct: 222 GHIFCNFCILSALGTTAATQKCPVCRRKV 250
>AMFR_MOUSE (Q9R049) Autocrine motility factor receptor (EC 6.3.2.19) (AMF| receptor) Length = 643 Score = 34.3 bits (77), Expect = 0.13 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = -2 Query: 421 GHIFCQKCIKASIQXXKKCPTCRRKLTISNFXR 323 GH+F C+++ ++ CPTCR L I++ R Sbjct: 357 GHLFHNSCLRSWLEQDTSCPTCRMSLNIADGSR 389
>BRE1A_CHICK (Q5ZLS3) Ubiquitin-protein ligase BRE1A (EC 6.3.2.-) (BRE1-A) (RING| finger protein 20) Length = 984 Score = 33.9 bits (76), Expect = 0.17 Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -2 Query: 418 HIFCQKCIKASIQXX-KKCPTCRRKLTISNFXRVYL 314 H+FC +C+K +KCP C ++F R+Y+ Sbjct: 948 HVFCFECVKTRYDTRQRKCPKCNAAFGANDFHRIYI 983
>BRE1A_HUMAN (Q5VTR2) Ubiquitin-protein ligase BRE1A (EC 6.3.2.-) (BRE1-A) (RING| finger protein 20) Length = 975 Score = 33.9 bits (76), Expect = 0.17 Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -2 Query: 418 HIFCQKCIKASIQXX-KKCPTCRRKLTISNFXRVYL 314 H+FC +C+K +KCP C ++F R+Y+ Sbjct: 939 HVFCFECVKTRYDTRQRKCPKCNAAFGANDFHRIYI 974
>BRE1_CAEBR (Q60YN5) Ubiquitin-protein ligase bre-1 (EC 6.3.2.-) (RING finger| protein rfp-1) Length = 828 Score = 33.9 bits (76), Expect = 0.17 Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -2 Query: 418 HIFCQKCIKASIQXX-KKCPTCRRKLTISNFXRVYL 314 H+FC+ CIK +KCP C ++F R+++ Sbjct: 793 HLFCETCIKTMYDTRQRKCPKCNSNFGANDFHRIFI 828
>BRE1A_MOUSE (Q5DTM8) Ubiquitin-protein ligase BRE1A (EC 6.3.2.-) (BRE1-A) (RING| finger protein 20) Length = 973 Score = 33.9 bits (76), Expect = 0.17 Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -2 Query: 418 HIFCQKCIKASIQXX-KKCPTCRRKLTISNFXRVYL 314 H+FC +C+K +KCP C ++F R+Y+ Sbjct: 937 HVFCFECVKTRYDTRQRKCPKCNAAFGANDFHRIYI 972
>RFWD2_HUMAN (Q8NHY2) Ring finger and WD repeat domain protein 2 (EC 6.3.2.-)| (Ubiquitin-protein ligase COP1) (Constitutive photomorphogenesis protein 1 homolog) (hCOP1) Length = 731 Score = 33.9 bits (76), Expect = 0.17 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -2 Query: 421 GHIFCQKCIKASIQXXKKCPTCRRKLTISNFXRVY 317 GH FC KCI S++ +CP C + N +Y Sbjct: 152 GHSFCYKCIHQSLEDNNRCPKC--NYVVDNIDHLY 184
>RN141_BRARE (Q6IV56) RING finger protein 141| Length = 222 Score = 33.9 bits (76), Expect = 0.17 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -2 Query: 418 HIFCQKCIKASIQXXKKCPTCRRKLTISN 332 H FCQKCI + CP CR ++T +N Sbjct: 163 HSFCQKCIDKWSGQSRNCPVCRIQVTAAN 191
>BRE1_CAEEL (P34537) Ubiquitin-protein ligase bre-1 (EC 6.3.2.-) (RING finger| protein rfp-1) Length = 837 Score = 33.9 bits (76), Expect = 0.17 Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -2 Query: 418 HIFCQKCIKASIQXX-KKCPTCRRKLTISNFXRVYL 314 H+FC+ CIK +KCP C ++F R+++ Sbjct: 802 HLFCETCIKTMYDTRQRKCPKCNSNFGANDFHRIFI 837
>RFWD2_MOUSE (Q9R1A8) Ring finger and WD repeat domain protein 2 (EC 6.3.2.-)| (Ubiquitin-protein ligase COP1) (Constitutive photomorphogenesis protein 1 homolog) (mCOP1) Length = 733 Score = 33.9 bits (76), Expect = 0.17 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -2 Query: 421 GHIFCQKCIKASIQXXKKCPTCRRKLTISNFXRVY 317 GH FC KCI S++ +CP C + N +Y Sbjct: 154 GHSFCYKCIHQSLEDNNRCPKC--NYVVDNIDHLY 186
>BRE1_KLULA (Q6CWM4) Ubiquitin-protein ligase BRE1 (EC 6.3.2.-)| Length = 663 Score = 33.5 bits (75), Expect = 0.22 Identities = 12/37 (32%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = -2 Query: 421 GHIFCQKCIKASIQXX-KKCPTCRRKLTISNFXRVYL 314 GH+FC C K + +KCPTC + + ++ ++L Sbjct: 627 GHVFCDVCCKERLAARMRKCPTCNKPFSSNDLLSIHL 663
>RAD18_CANGA (Q6FPI4) Postreplication repair ubiquitin-protein ligase E3 RAD18| (EC 6.-.-.-) Length = 411 Score = 33.5 bits (75), Expect = 0.22 Identities = 14/36 (38%), Positives = 17/36 (47%) Frame = -2 Query: 421 GHIFCQKCIKASIQXXKKCPTCRRKLTISNFXRVYL 314 GH FC CI+ + KCP C +L S YL Sbjct: 43 GHTFCSLCIRGYLSNEPKCPLCLHELRESMLRSEYL 78
>RN141_RAT (Q6IV57) RING finger protein 141| Length = 230 Score = 33.5 bits (75), Expect = 0.22 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -2 Query: 418 HIFCQKCIKASIQXXKKCPTCRRKLTISN 332 H FCQKCI + CP CR ++T +N Sbjct: 171 HSFCQKCIDKWSDRHRNCPICRLQMTGAN 199
>RN141_PONPY (Q5R7K8) RING finger protein 141| Length = 230 Score = 33.5 bits (75), Expect = 0.22 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -2 Query: 418 HIFCQKCIKASIQXXKKCPTCRRKLTISN 332 H FCQKCI + CP CR ++T +N Sbjct: 171 HSFCQKCIDKWSDRHRNCPICRLQMTGAN 199
>RN141_MOUSE (Q99MB7) RING finger protein 141 (Zinc finger protein 230)| Length = 230 Score = 33.5 bits (75), Expect = 0.22 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -2 Query: 418 HIFCQKCIKASIQXXKKCPTCRRKLTISN 332 H FCQKCI + CP CR ++T +N Sbjct: 171 HSFCQKCIDKWSDRHRNCPICRLQMTGAN 199
>RN141_HUMAN (Q8WVD5) RING finger protein 141 (Zinc finger protein 230)| Length = 230 Score = 33.5 bits (75), Expect = 0.22 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -2 Query: 418 HIFCQKCIKASIQXXKKCPTCRRKLTISN 332 H FCQKCI + CP CR ++T +N Sbjct: 171 HSFCQKCIDKWSDRHRNCPICRLQMTGAN 199
>PEX10_MACFA (Q8HXW8) Peroxisome assembly protein 10 (Peroxin-10) (Peroxisome| biogenesis factor 10) Length = 326 Score = 33.5 bits (75), Expect = 0.22 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -2 Query: 421 GHIFCQKCIKASIQXXKKCPTCRRK 347 GH+FC +CI A +CP CR K Sbjct: 289 GHLFCWECITAWCSSKAECPLCREK 313
>PEX10_HUMAN (O60683) Peroxisome assembly protein 10 (Peroxin-10) (Peroxisome| biogenesis factor 10) (RING finger protein 69) Length = 326 Score = 33.5 bits (75), Expect = 0.22 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -2 Query: 421 GHIFCQKCIKASIQXXKKCPTCRRK 347 GH+FC +CI A +CP CR K Sbjct: 289 GHLFCWECITAWCSSKAECPLCREK 313
>BRE1B_RAT (Q8CJB9) Ubiquitin-protein ligase BRE1B (EC 6.3.2.-) (BRE1-B) (RING| finger protein 40) (Syntaxin-1-interacting RING finger protein) (Protein staring) Length = 1002 Score = 33.1 bits (74), Expect = 0.29 Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -2 Query: 418 HIFCQKCIKASIQXX-KKCPTCRRKLTISNFXRVYL 314 H+FC +C++ + +KCP C +F RVY+ Sbjct: 966 HVFCFECVRGRYEARQRKCPKCNAAFGAHDFHRVYI 1001
>SM3L1_ARATH (Q9FF61) Putative SWI/SNF-related matrix-associated actin-dependent| regulator of chromatin subfamily A member 3-like 1 (EC 3.6.1.-) (SMARCA3-like protein 1) Length = 881 Score = 33.1 bits (74), Expect = 0.29 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 1/30 (3%) Frame = -2 Query: 418 HIFCQKCIKASIQXXKK-CPTCRRKLTISN 332 HIFC+ CI ++Q K CP CR LT S+ Sbjct: 652 HIFCRACILQTLQRSKPLCPLCRGSLTQSD 681
>ATL5L_ARATH (Q9FIR0) Putative RING-H2 finger protein ATL5L| Length = 289 Score = 33.1 bits (74), Expect = 0.29 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 Query: 418 HIFCQKCIKASIQXXKKCPTCRRKL 344 H+F Q+CI ++ K CP CRR L Sbjct: 136 HVFHQECIDQWLESNKTCPVCRRNL 160
>BRE1B_MOUSE (Q3U319) Ubiquitin-protein ligase BRE1B (EC 6.3.2.-) (BRE1-B) (RING| finger protein 40) Length = 1001 Score = 33.1 bits (74), Expect = 0.29 Identities = 12/36 (33%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -2 Query: 418 HIFCQKCIKASIQXX-KKCPTCRRKLTISNFXRVYL 314 H+FC +C++ + +KCP C +F RVY+ Sbjct: 965 HVFCFECVRGRYEARQRKCPKCNAAFGAHDFHRVYI 1000
>RN125_MOUSE (Q9D9R0) RING finger protein 125 (EC 6.3.2.-)| Length = 232 Score = 32.7 bits (73), Expect = 0.38 Identities = 14/28 (50%), Positives = 17/28 (60%), Gaps = 2/28 (7%) Frame = -2 Query: 421 GHIFCQKCIKASIQXXKK--CPTCRRKL 344 GH+FC+ CI SI+ K CP CR L Sbjct: 52 GHVFCRSCIATSIKNNNKWTCPYCRAYL 79
>RING1_MACMU (Q8WMN5) Polycomb complex protein RING1 (RING finger protein 1)| Length = 377 Score = 32.7 bits (73), Expect = 0.38 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = -2 Query: 418 HIFCQKCIKASIQXX-KKCPTCRRKL 344 H FC CI +++ K+CPTCR+KL Sbjct: 37 HRFCSDCIVTALRSGNKECPTCRKKL 62
>RING1_DROME (Q9VB08) Ubiquitin ligase protein RING1 (EC 6.3.2.-) (dRING1)| (dRING protein) (Sex comb extra protein) Length = 435 Score = 32.7 bits (73), Expect = 0.38 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = -2 Query: 418 HIFCQKCIKASIQXX-KKCPTCRRKL 344 H FC CI +++ K+CPTCR+KL Sbjct: 64 HRFCSDCIVTALRSGNKECPTCRKKL 89
>RING1_RAT (Q6MGB6) Polycomb complex protein RING1 (RING finger protein 1)| Length = 406 Score = 32.7 bits (73), Expect = 0.38 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = -2 Query: 418 HIFCQKCIKASIQXX-KKCPTCRRKL 344 H FC CI +++ K+CPTCR+KL Sbjct: 66 HRFCSDCIVTALRSGNKECPTCRKKL 91
>RING1_MOUSE (O35730) Polycomb complex protein RING1 (RING finger protein 1)| (Transcription repressor Ring1A) Length = 406 Score = 32.7 bits (73), Expect = 0.38 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = -2 Query: 418 HIFCQKCIKASIQXX-KKCPTCRRKL 344 H FC CI +++ K+CPTCR+KL Sbjct: 66 HRFCSDCIVTALRSGNKECPTCRKKL 91
>RING1_HUMAN (Q06587) Polycomb complex protein RING1 (RING finger protein 1)| Length = 406 Score = 32.7 bits (73), Expect = 0.38 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = -2 Query: 418 HIFCQKCIKASIQXX-KKCPTCRRKL 344 H FC CI +++ K+CPTCR+KL Sbjct: 66 HRFCSDCIVTALRSGNKECPTCRKKL 91
>RING1_CANFA (Q5TJF3) Ubiquitin ligase protein RING1 (EC 6.3.2.-) (RING finger| protein 1) (RING1a) Length = 406 Score = 32.7 bits (73), Expect = 0.38 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = -2 Query: 418 HIFCQKCIKASIQXX-KKCPTCRRKL 344 H FC CI +++ K+CPTCR+KL Sbjct: 66 HRFCSDCIVTALRSGNKECPTCRKKL 91
>BRE1_ASHGO (Q757D9) Ubiquitin-protein ligase BRE1 (EC 6.3.2.-)| Length = 643 Score = 32.7 bits (73), Expect = 0.38 Identities = 13/37 (35%), Positives = 21/37 (56%), Gaps = 1/37 (2%) Frame = -2 Query: 421 GHIFCQKCIKASIQXX-KKCPTCRRKLTISNFXRVYL 314 GH+FC C K + +KCPTC + + ++ V+L Sbjct: 607 GHVFCADCCKERLAARMRKCPTCNKGFSSNDLLVVHL 643
>RNG2B_XENLA (Q7ZWM8) Ubiquitin ligase protein RING2-B (EC 6.3.2.-) (RING finger| protein 2-B) (RING finger protein 1B-B) (RING1b-B) Length = 343 Score = 32.7 bits (73), Expect = 0.38 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = -2 Query: 418 HIFCQKCIKASIQXX-KKCPTCRRKL 344 H FC CI +++ K+CPTCR+KL Sbjct: 65 HRFCSDCIVTALRSGNKECPTCRKKL 90
>PEX12_DROME (Q9VPT5) Putative peroxisome assembly protein 12 (Peroxin-12)| Length = 297 Score = 32.7 bits (73), Expect = 0.38 Identities = 10/38 (26%), Positives = 22/38 (57%) Frame = -2 Query: 430 TIXGHIFCQKCIKASIQXXKKCPTCRRKLTISNFXRVY 317 ++ G++FC KCI + ++ CP +++ + R+Y Sbjct: 258 SVSGYVFCWKCIVSHMKEHGTCPVTHYPISLDDLVRIY 295
>RAD18_EMENI (Q02398) Postreplication repair ubiquitin-protein ligase E3 rad18| (EC 6.-.-.-) Length = 443 Score = 32.7 bits (73), Expect = 0.38 Identities = 12/26 (46%), Positives = 14/26 (53%) Frame = -2 Query: 430 TIXGHIFCQKCIKASIQXXKKCPTCR 353 T H FC CI+ + KCPTCR Sbjct: 43 TSCSHTFCSLCIRRCLSTEGKCPTCR 68
>RNG2A_XENLA (Q66J69) Ubiquitin ligase protein RING2-A (EC 6.3.2.-) (RING finger| protein 2-A) (RING finger protein 1B-A) (RING1b-A) Length = 344 Score = 32.7 bits (73), Expect = 0.38 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = -2 Query: 418 HIFCQKCIKASIQXX-KKCPTCRRKL 344 H FC CI +++ K+CPTCR+KL Sbjct: 66 HRFCSDCIVTALRSGNKECPTCRKKL 91
>COP1_PEA (P93471) Ubiquitin ligase protein COP1 (EC 6.3.2.-) (Constitutive| photomorphogenesis protein 1) Length = 672 Score = 32.7 bits (73), Expect = 0.38 Identities = 15/39 (38%), Positives = 18/39 (46%) Frame = -2 Query: 430 TIXGHIFCQKCIKASIQXXKKCPTCRRKLTISNFXRVYL 314 T GH FC CI ++ CP C LT SN +L Sbjct: 60 TACGHSFCYMCIITHLRNKSDCPCCGHYLTNSNLFPNFL 98
>BRE1B_PONPY (Q5RAU7) Ubiquitin-protein ligase BRE1B (EC 6.3.2.-) (BRE1-B) (RING| finger protein 40) Length = 1001 Score = 32.7 bits (73), Expect = 0.38 Identities = 11/36 (30%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -2 Query: 418 HIFCQKCIKASIQXX-KKCPTCRRKLTISNFXRVYL 314 H+FC +C++ + +KCP C +F R+Y+ Sbjct: 965 HVFCFECVRGRYEARQRKCPKCNAAFGAHDFHRIYI 1000
>BRE1B_MACFA (Q4R7K7) Ubiquitin-protein ligase BRE1B (EC 6.3.2.-) (BRE1-B) (RING| finger protein 40) Length = 1001 Score = 32.7 bits (73), Expect = 0.38 Identities = 11/36 (30%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -2 Query: 418 HIFCQKCIKASIQXX-KKCPTCRRKLTISNFXRVYL 314 H+FC +C++ + +KCP C +F R+Y+ Sbjct: 965 HVFCFECVRGRYEARQRKCPKCNAAFGAHDFHRIYI 1000
>BRE1B_HUMAN (O75150) Ubiquitin-protein ligase BRE1B (EC 6.3.2.-) (BRE1-B) (RING| finger protein 40) (95 kDa retinoblastoma-associated protein) (RBP95) Length = 1001 Score = 32.7 bits (73), Expect = 0.38 Identities = 11/36 (30%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -2 Query: 418 HIFCQKCIKASIQXX-KKCPTCRRKLTISNFXRVYL 314 H+FC +C++ + +KCP C +F R+Y+ Sbjct: 965 HVFCFECVRGRYEARQRKCPKCNAAFGAHDFHRIYI 1000
>PEX10_ARATH (Q9SYU4) Peroxisome assembly protein 10 (Peroxin-10) (AthPEX10)| (Pex10p) (PER8) Length = 381 Score = 32.3 bits (72), Expect = 0.50 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -2 Query: 421 GHIFCQKCIKASIQXXKKCPTCRRKLTISNFXRVY 317 GH+FC CI ++CP CR T S+ +Y Sbjct: 343 GHVFCWSCIMEWCNEKQECPLCRTPNTHSSLVCLY 377
>CM007_PONPY (Q5RD97) Protein C13orf7 homolog| Length = 726 Score = 32.3 bits (72), Expect = 0.50 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -2 Query: 427 IXGHIFCQKCIKASIQXXKKCPTCRRKLTISN 332 I H+FC CI ++ +CP CR +T N Sbjct: 32 INNHVFCSICIDLWLKNNSQCPACRVPITPEN 63
>CM007_HUMAN (Q5W0B1) Protein C13orf7| Length = 726 Score = 32.3 bits (72), Expect = 0.50 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -2 Query: 427 IXGHIFCQKCIKASIQXXKKCPTCRRKLTISN 332 I H+FC CI ++ +CP CR +T N Sbjct: 32 INNHVFCSICIDLWLKNNSQCPACRVPITPEN 63
>BRE1_DEBHA (Q6BWW6) Ubiquitin-protein ligase BRE1 (EC 6.3.2.-)| Length = 691 Score = 32.3 bits (72), Expect = 0.50 Identities = 11/40 (27%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -2 Query: 430 TIXGHIFCQKCIKASIQXX-KKCPTCRRKLTISNFXRVYL 314 T+ GH+FC C + + ++CPTC + + ++ ++L Sbjct: 652 TVCGHVFCLGCTQERLAARLRRCPTCNKGFSANDLLSIHL 691
>BRE1_GIBZE (Q4I7N9) Ubiquitin-protein ligase BRE1 (EC 6.3.2.-)| Length = 703 Score = 32.0 bits (71), Expect = 0.65 Identities = 12/25 (48%), Positives = 16/25 (64%), Gaps = 1/25 (4%) Frame = -2 Query: 421 GHIFCQKCIKASI-QXXKKCPTCRR 350 GH+FC +C+ I +KCPTC R Sbjct: 667 GHLFCNQCVDDRISNRMRKCPTCSR 691
>RING2_PONPY (Q5R9J5) Ubiquitin ligase protein RING2 (EC 6.3.2.-) (RING finger| protein 2) (RING finger protein 1B) (RING1b) Length = 336 Score = 32.0 bits (71), Expect = 0.65 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = -2 Query: 418 HIFCQKCIKASIQXX-KKCPTCRRKL 344 H FC CI +++ K+CPTCR+KL Sbjct: 69 HRFCADCIITALRSGNKECPTCRKKL 94
>RING2_MOUSE (Q9CQJ4) Ubiquitin ligase protein RING2 (EC 6.3.2.-) (RING finger| protein 2) (RING finger protein 1B) (RING1b) Length = 336 Score = 32.0 bits (71), Expect = 0.65 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = -2 Query: 418 HIFCQKCIKASIQXX-KKCPTCRRKL 344 H FC CI +++ K+CPTCR+KL Sbjct: 69 HRFCADCIITALRSGNKECPTCRKKL 94
>RING2_HUMAN (Q99496) Ubiquitin ligase protein RING2 (EC 6.3.2.-) (RING finger| protein 2) (RING finger protein 1B) (RING1b) (RING finger protein BAP-1) (DinG protein) (Huntingtin-interacting protein 2-interacting protein 3) (HIP2-interacting protein 3) Length = 336 Score = 32.0 bits (71), Expect = 0.65 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = -2 Query: 418 HIFCQKCIKASIQXX-KKCPTCRRKL 344 H FC CI +++ K+CPTCR+KL Sbjct: 69 HRFCADCIITALRSGNKECPTCRKKL 94
>RING2_BRARE (Q803I4) Ubiquitin ligase protein RING2 (EC 6.3.2.-) (RING finger| protein 2) (RING finger protein 1B) (RING1b) Length = 336 Score = 32.0 bits (71), Expect = 0.65 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = -2 Query: 418 HIFCQKCIKASIQXX-KKCPTCRRKL 344 H FC CI +++ K+CPTCR+KL Sbjct: 69 HRFCADCIITALRSGNKECPTCRKKL 94
>RN125_MACFA (Q95KF1) RING finger protein 125 (EC 6.3.2.-)| Length = 231 Score = 32.0 bits (71), Expect = 0.65 Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = -2 Query: 421 GHIFCQKCIKASIQXXK-KCPTCRRKL 344 GH+FC+ CI S++ K CP CR L Sbjct: 52 GHVFCRSCIATSLKNNKWTCPYCRAYL 78
>RN125_HUMAN (Q96EQ8) RING finger protein 125 (EC 6.3.2.-) (T-cell RING| activation protein 1) (TRAC-1) Length = 231 Score = 32.0 bits (71), Expect = 0.65 Identities = 13/27 (48%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = -2 Query: 421 GHIFCQKCIKASIQXXK-KCPTCRRKL 344 GH+FC+ CI S++ K CP CR L Sbjct: 52 GHVFCRSCIATSLKNNKWTCPYCRAYL 78
>RING2_RAT (Q4KLY4) Ubiquitin ligase protein RING2 (EC 6.3.2.-) (RING finger| protein 2) (RING finger protein 1B) (RING1b) Length = 308 Score = 32.0 bits (71), Expect = 0.65 Identities = 13/26 (50%), Positives = 18/26 (69%), Gaps = 1/26 (3%) Frame = -2 Query: 418 HIFCQKCIKASIQXX-KKCPTCRRKL 344 H FC CI +++ K+CPTCR+KL Sbjct: 69 HRFCADCIITALRSGNKECPTCRKKL 94
>YNN1_CAEEL (Q03605) Hypothetical RING finger protein T02C1.1 in chromosome III| Length = 160 Score = 32.0 bits (71), Expect = 0.65 Identities = 10/23 (43%), Positives = 16/23 (69%) Frame = -2 Query: 421 GHIFCQKCIKASIQXXKKCPTCR 353 GH +C+ CI++ + +KCP CR Sbjct: 24 GHSYCRFCIESHLNINEKCPLCR 46
>RAD18_DEBHA (Q6BLM3) Postreplication repair ubiquitin-protein ligase E3 RAD18| (EC 6.-.-.-) Length = 491 Score = 31.6 bits (70), Expect = 0.85 Identities = 14/39 (35%), Positives = 18/39 (46%) Frame = -2 Query: 430 TIXGHIFCQKCIKASIQXXKKCPTCRRKLTISNFXRVYL 314 T H FC CI+ + CP C+ + SN RV L Sbjct: 49 TSCNHTFCSHCIREYLIVNSHCPLCKAEQFESNLKRVIL 87
>BRE1_YARLI (Q6CF78) Ubiquitin-protein ligase BRE1 (EC 6.3.2.-)| Length = 700 Score = 31.6 bits (70), Expect = 0.85 Identities = 11/39 (28%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = -2 Query: 427 IXGHIFCQKCIKASIQX-XKKCPTCRRKLTISNFXRVYL 314 + GH+FC +C + + +KCP C + + ++ V+L Sbjct: 662 VCGHVFCHQCAQDRLDARLRKCPNCNKPFSQNDLLTVHL 700
>CM007_MOUSE (Q8K2Y0) Protein C13orf7 homolog| Length = 722 Score = 31.2 bits (69), Expect = 1.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -2 Query: 418 HIFCQKCIKASIQXXKKCPTCRRKLTISN 332 H+FC CI ++ +CP CR +T N Sbjct: 35 HVFCSICIDLWLKNNSQCPACRVPITPEN 63
>DTX3_MOUSE (Q80V91) Protein deltex-3 (Deltex-3) (Deltex3) (mDTX3)| Length = 347 Score = 31.2 bits (69), Expect = 1.1 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -2 Query: 418 HIFCQKCIKASIQXXKKCPTCRR 350 H FC+ CI ++Q K CP C R Sbjct: 182 HSFCEGCITRALQVKKACPMCGR 204
>DTX3_HUMAN (Q8N9I9) Protein deltex-3 (Deltex-3) (Deltex3)| Length = 347 Score = 31.2 bits (69), Expect = 1.1 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -2 Query: 418 HIFCQKCIKASIQXXKKCPTCRR 350 H FC+ CI ++Q K CP C R Sbjct: 182 HSFCEGCITRALQVKKACPMCGR 204
>BRE1_DROME (Q9VRP9) Ubiquitin-protein ligase Bre1 (EC 6.3.2.-) (dBre1)| Length = 1044 Score = 31.2 bits (69), Expect = 1.1 Identities = 11/36 (30%), Positives = 20/36 (55%), Gaps = 1/36 (2%) Frame = -2 Query: 418 HIFCQKCIKASIQXX-KKCPTCRRKLTISNFXRVYL 314 H+FC C++ + +KCP C +++ R+YL Sbjct: 1008 HVFCYDCLRTRYETRQRKCPKCNCAFGANDYHRLYL 1043
>COP1_ARATH (P43254) Ubiquitin-protein ligase COP1 (EC 6.3.2.-) (Constitutive| photomorphogenesis protein 1) Length = 675 Score = 30.8 bits (68), Expect = 1.5 Identities = 12/30 (40%), Positives = 15/30 (50%) Frame = -2 Query: 430 TIXGHIFCQKCIKASIQXXKKCPTCRRKLT 341 T GH FC CI ++ CP C + LT Sbjct: 65 TACGHSFCYMCIITHLRNKSDCPCCSQHLT 94
>LNX2_MOUSE (Q91XL2) Ligand of Numb-protein X 2 (Numb-binding protein 2)| Length = 687 Score = 30.8 bits (68), Expect = 1.5 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -2 Query: 421 GHIFCQKCIKASIQXXKKCPTCRRKL 344 GH FC KC++ +Q CP R++L Sbjct: 67 GHTFCHKCLRNFLQEKDFCPLDRKRL 92
>RAD18_ASPFU (Q4WZJ6) Postreplication repair ubiquitin-protein ligase E3 rad18| (EC 6.-.-.-) Length = 418 Score = 30.8 bits (68), Expect = 1.5 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -2 Query: 430 TIXGHIFCQKCIKASIQXXKKCPTCR 353 T H FC CI+ + KCP CR Sbjct: 43 TSCSHTFCSLCIRRCLSTEGKCPACR 68
>PEX10_SCHPO (Q9UUF0) Peroxisome assembly protein 10 (Peroxin-10) (Peroxisome| biogenesis factor 10) Length = 306 Score = 30.8 bits (68), Expect = 1.5 Identities = 11/23 (47%), Positives = 12/23 (52%) Frame = -2 Query: 421 GHIFCQKCIKASIQXXKKCPTCR 353 GHIFC CI +CP CR Sbjct: 272 GHIFCWSCINGWTSKKSECPLCR 294
>RAD18_NEUCR (P33288) Postreplication repair ubiquitin-protein ligase E3 rad-18| (EC 6.-.-.-) (UV radiation sensitivity protein 2) Length = 501 Score = 30.8 bits (68), Expect = 1.5 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = -2 Query: 430 TIXGHIFCQKCIKASIQXXKKCPTCR 353 T H FC CI+ + KCP CR Sbjct: 47 TSCNHTFCSLCIRRCLSVDSKCPLCR 72
>ATL4I_ARATH (O49691) Putative RING-H2 finger protein ATL4I| Length = 289 Score = 30.8 bits (68), Expect = 1.5 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = -2 Query: 418 HIFCQKCIKASIQXXKKCPTCRRKL 344 H+F Q+CI + + CP CRR L Sbjct: 131 HVFHQECIDLWFESHRTCPVCRRDL 155
>BRE1_SCHPO (O74563) Ubiquitin-protein ligase bre1 (EC 6.3.2.-)| Length = 680 Score = 30.4 bits (67), Expect = 1.9 Identities = 13/40 (32%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -2 Query: 430 TIXGHIFCQKCIKASIQX-XKKCPTCRRKLTISNFXRVYL 314 ++ GH FC +CI+ I+ ++CP C R S+ ++L Sbjct: 641 SLCGHGFCYQCIQKRIETRQRRCPICGRGFGASDVIPIHL 680
>RN146_RAT (Q5XIK5) RING finger protein 146| Length = 352 Score = 30.4 bits (67), Expect = 1.9 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = -2 Query: 418 HIFCQKCIKASIQXXKKCPTCRRKL 344 H+FC C+K + K+C CR+++ Sbjct: 53 HVFCYLCVKGASWLGKRCALCRQEI 77
>RAD18_ASHGO (Q75EN0) Postreplication repair ubiquitin-protein ligase E3 RAD18| (EC 6.-.-.-) Length = 443 Score = 30.4 bits (67), Expect = 1.9 Identities = 11/36 (30%), Positives = 18/36 (50%) Frame = -2 Query: 421 GHIFCQKCIKASIQXXKKCPTCRRKLTISNFXRVYL 314 GH FC CI+ + +CP C +L + + +L Sbjct: 48 GHTFCSLCIREYLNKESRCPLCLAELRQNMLQKEFL 83
>RN146_MOUSE (Q9CZW6) RING finger protein 146| Length = 359 Score = 30.4 bits (67), Expect = 1.9 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = -2 Query: 418 HIFCQKCIKASIQXXKKCPTCRRKL 344 H+FC C+K + K+C CR+++ Sbjct: 55 HVFCYLCVKGASWLGKRCALCRQEI 79
>RN146_HUMAN (Q9NTX7) RING finger protein 146 (Dactylidin)| Length = 359 Score = 30.4 bits (67), Expect = 1.9 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = -2 Query: 418 HIFCQKCIKASIQXXKKCPTCRRKL 344 H+FC C+K + K+C CR+++ Sbjct: 54 HVFCYLCVKGASWLGKRCALCRQEI 78
>LNX2_HUMAN (Q8N448) Ligand of Numb-protein X 2 (Numb-binding protein 2) (PDZ| domain-containing RING finger protein 1) Length = 690 Score = 30.4 bits (67), Expect = 1.9 Identities = 11/26 (42%), Positives = 16/26 (61%) Frame = -2 Query: 421 GHIFCQKCIKASIQXXKKCPTCRRKL 344 GH FC KC++ +Q CP R++L Sbjct: 66 GHTFCYKCLRNFLQEKDFCPLDRKRL 91
>RN146_PONPY (Q5REL3) RING finger protein 146| Length = 358 Score = 30.4 bits (67), Expect = 1.9 Identities = 9/25 (36%), Positives = 16/25 (64%) Frame = -2 Query: 418 HIFCQKCIKASIQXXKKCPTCRRKL 344 H+FC C+K + K+C CR+++ Sbjct: 53 HVFCYLCVKGASWLGKRCALCRQEI 77
>SAN1_YEAST (P22470) Protein SAN1| Length = 610 Score = 30.0 bits (66), Expect = 2.5 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -2 Query: 421 GHIFCQKCIKASIQXXKKCPTCRRKLTIS 335 GHIF ++CI + CP CR+K++ S Sbjct: 258 GHIFGRECIYKWSRLENSCPLCRQKISES 286
>RO52_HUMAN (P19474) 52 kDa Ro protein (Sjoegren syndrome type A antigen)| (SS-A) (Ro(SS-A)) (52 kDa ribonucleoprotein autoantigen Ro/SS-A) (Tripartite motif protein 21) (RING finger protein 81) Length = 475 Score = 30.0 bits (66), Expect = 2.5 Identities = 12/31 (38%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = -2 Query: 421 GHIFCQKCI-KASIQXXKKCPTCRRKLTISN 332 GH FCQ+CI + CP CR++ + N Sbjct: 32 GHSFCQECISQVGKGGGSVCPVCRQRFLLKN 62
>PEX10_YEAST (Q05568) Peroxisome assembly protein 10 (Peroxin-10) (Peroxisome| biogenesis factor 10) Length = 337 Score = 29.6 bits (65), Expect = 3.2 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -2 Query: 421 GHIFCQKCIKASIQXXKKCPTCRR 350 GH+FC C+ + + +CP CR+ Sbjct: 302 GHLFCWSCLMSWCKERPECPLCRQ 325
>RAD5_CANGA (Q6FY76) DNA repair protein RAD5 (EC 3.6.1.-)| Length = 1151 Score = 29.6 bits (65), Expect = 3.2 Identities = 12/34 (35%), Positives = 21/34 (61%), Gaps = 6/34 (17%) Frame = -2 Query: 418 HIFCQKCIK--ASIQXXK----KCPTCRRKLTIS 335 H+FC++C++ + Q K KCP CRR + ++ Sbjct: 917 HVFCKECLEEYGNFQKEKSLQQKCPNCRRDINLN 950
>TRI12_MOUSE (Q99PQ1) Tripartite motif protein 12| Length = 284 Score = 29.6 bits (65), Expect = 3.2 Identities = 17/36 (47%), Positives = 18/36 (50%), Gaps = 6/36 (16%) Frame = -2 Query: 421 GHIFCQKCIK---ASIQXXKK---CPTCRRKLTISN 332 GH FCQ CI SI+ KK CP CR SN Sbjct: 31 GHTFCQGCITLYFESIKCDKKVFICPVCRISYQFSN 66
>PEX12_CAEEL (Q19189) Putative peroxisome assembly protein 12 (Peroxin-12)| Length = 359 Score = 29.6 bits (65), Expect = 3.2 Identities = 9/38 (23%), Positives = 18/38 (47%) Frame = -2 Query: 427 IXGHIFCQKCIKASIQXXKKCPTCRRKLTISNFXRVYL 314 + G++FC CI + KCP + + R+++ Sbjct: 322 VSGYVFCYTCINQYVNTYNKCPVTGCPANVQHLIRLFV 359
>BRE1_NEUCR (Q7S304) Ubiquitin-protein ligase bre-1 (EC 6.3.2.-)| Length = 707 Score = 29.6 bits (65), Expect = 3.2 Identities = 11/37 (29%), Positives = 20/37 (54%), Gaps = 1/37 (2%) Frame = -2 Query: 421 GHIFCQKCIKASI-QXXKKCPTCRRKLTISNFXRVYL 314 GH+FC +C+ + +KCP+C + S+ +L Sbjct: 671 GHVFCNECVDNRLANRMRKCPSCNKAFDRSDAMPAHL 707
>TRI40_RAT (Q6MFY8) Tripartite motif protein 40 (RING finger protein 35)| Length = 247 Score = 29.3 bits (64), Expect = 4.2 Identities = 11/28 (39%), Positives = 16/28 (57%), Gaps = 5/28 (17%) Frame = -2 Query: 418 HIFCQKCI-----KASIQXXKKCPTCRR 350 H+FC+ C+ KAS+ CP CR+ Sbjct: 29 HLFCRMCLIRHMDKASVSGVLSCPVCRK 56
>RO52_MOUSE (Q62191) 52 kDa Ro protein (Sjoegren syndrome type A antigen)| (SS-A) (Ro(SS-A)) (52 kDa ribonucleoprotein autoantigen Ro/SS-A) (Tripartite motif protein 21) Length = 470 Score = 29.3 bits (64), Expect = 4.2 Identities = 11/31 (35%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = -2 Query: 421 GHIFCQKCI-KASIQXXKKCPTCRRKLTISN 332 GH FC++CI + CP CR++ + N Sbjct: 36 GHCFCKECIFEVGKNGGSSCPECRQQFLLRN 66
>PEX12_ARATH (Q9M841) Putative peroxisome assembly protein 12 (Peroxin-12)| Length = 372 Score = 29.3 bits (64), Expect = 4.2 Identities = 9/38 (23%), Positives = 18/38 (47%) Frame = -2 Query: 430 TIXGHIFCQKCIKASIQXXKKCPTCRRKLTISNFXRVY 317 T+ G +FC C+ + K+CP ++ R++ Sbjct: 332 TVSGFVFCYSCVFKYVSKYKRCPVTLIPASVDQIRRLF 369
>TRI35_MOUSE (Q8C006) Tripartite motif protein 35 (Macrophage-derived| apoptosis-inducing RBCC protein) (MAIR protein) (Nc8 protein) (Hemopoeitic lineage switch protein 5) Length = 501 Score = 29.3 bits (64), Expect = 4.2 Identities = 9/27 (33%), Positives = 15/27 (55%), Gaps = 2/27 (7%) Frame = -2 Query: 421 GHIFCQKCIKA--SIQXXKKCPTCRRK 347 GH FC++C+ +Q CP C+ + Sbjct: 37 GHNFCRRCVSGCWEVQTTPSCPVCKER 63
>RN126_MOUSE (Q91YL2) RING finger protein 126| Length = 313 Score = 29.3 bits (64), Expect = 4.2 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -2 Query: 418 HIFCQKCIKASIQXXKKCPTCRRKLTISN 332 H+F CI ++ CP CR+ LT N Sbjct: 251 HLFHDSCIVPWLEQHDSCPVCRKSLTGQN 279
>RAD5_YEAST (P32849) DNA repair protein RAD5 (EC 3.6.1.-) (Radiation sensitivity| protein 5) (Revertibility protein 2) Length = 1169 Score = 29.3 bits (64), Expect = 4.2 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 6/32 (18%) Frame = -2 Query: 421 GHIFCQKCIKASIQXXK------KCPTCRRKL 344 GH FC+KC+ I+ KCP CR ++ Sbjct: 933 GHSFCEKCLFEYIEFQNSKNLGLKCPNCRNQI 964
>CWC24_CANGA (Q6FXX1) Pre-mRNA-splicing factor CWC24| Length = 226 Score = 28.9 bits (63), Expect = 5.5 Identities = 11/22 (50%), Positives = 12/22 (54%) Frame = -2 Query: 421 GHIFCQKCIKASIQXXKKCPTC 356 GH FCQKC I+ K C C Sbjct: 181 GHYFCQKCFVNRIKIDKSCFIC 202
>SMRA3_HUMAN (Q14527) SWI/SNF-related matrix-associated actin-dependent| regulator of chromatin subfamily A member 3 (EC 3.6.1.-) (Sucrose nonfermenting protein 2-like 3) (DNA binding protein/plasminogen activator inhibitor 1 regulator) (Helicase-like tran Length = 1009 Score = 28.9 bits (63), Expect = 5.5 Identities = 13/32 (40%), Positives = 17/32 (53%), Gaps = 3/32 (9%) Frame = -2 Query: 418 HIFCQKCIKASIQXXK---KCPTCRRKLTISN 332 H+FC+ CI IQ + KCP CR + N Sbjct: 777 HVFCKPCICQVIQNEQPHAKCPLCRNDIHEDN 808
>ATL2A_ARATH (O22755) RING-H2 finger protein ATL2A (RING-H2 zinc finger protein| RHA3a) Length = 185 Score = 28.9 bits (63), Expect = 5.5 Identities = 12/27 (44%), Positives = 15/27 (55%) Frame = -2 Query: 421 GHIFCQKCIKASIQXXKKCPTCRRKLT 341 GH F +CI + CP+CRR LT Sbjct: 122 GHSFHVECIDKWLVSRSSCPSCRRILT 148
>ICP0_HHV11 (P08393) Trans-acting transcriptional protein ICP0 (Immediate-early| protein IE110) (VMW110) (Alpha-0 protein) Length = 775 Score = 28.9 bits (63), Expect = 5.5 Identities = 11/25 (44%), Positives = 13/25 (52%) Frame = -2 Query: 418 HIFCQKCIKASIQXXKKCPTCRRKL 344 H FC C+K +Q CP C KL Sbjct: 136 HRFCIPCMKTWMQLRNTCPLCNAKL 160
>RN113_CAEEL (O17917) Putative RING finger protein 113 homolog| Length = 384 Score = 28.9 bits (63), Expect = 5.5 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = -2 Query: 418 HIFCQKCIKASIQXXKKCPTCRR 350 H FC C S Q KCP C++ Sbjct: 258 HYFCTGCALKSFQKSSKCPICQQ 280
>RAD18_YEAST (P10862) Postreplication repair ubiquitin-protein ligase E3 RAD18| (EC 6.-.-.-) (Radiation sensitivity protein 18) Length = 487 Score = 28.9 bits (63), Expect = 5.5 Identities = 9/22 (40%), Positives = 11/22 (50%) Frame = -2 Query: 421 GHIFCQKCIKASIQXXKKCPTC 356 GH FC CI+ + CP C Sbjct: 44 GHTFCSLCIRTHLNNQPNCPLC 65
>SMRA3_RABIT (Q95216) SWI/SNF-related matrix-associated actin-dependent| regulator of chromatin subfamily A member 3 (EC 3.6.1.-) (Sucrose nonfermenting protein 2-like 3) (RUSH-1) Length = 1005 Score = 28.9 bits (63), Expect = 5.5 Identities = 12/28 (42%), Positives = 16/28 (57%), Gaps = 3/28 (10%) Frame = -2 Query: 418 HIFCQKCIKASIQXXK---KCPTCRRKL 344 H+FC+ CI IQ + KCP CR + Sbjct: 774 HVFCKPCICQCIQNEQPHAKCPLCRNDI 801
>ATL3I_ARATH (Q7X843) RING-H2 finger protein ATL3I (YGHL1-C3HC4 RING fusion| protein) Length = 349 Score = 28.9 bits (63), Expect = 5.5 Identities = 12/32 (37%), Positives = 15/32 (46%) Frame = -2 Query: 427 IXGHIFCQKCIKASIQXXKKCPTCRRKLTISN 332 + H F CI + CP CRR L+ SN Sbjct: 225 VCSHAFHLHCIDTWLLSNSTCPLCRRSLSTSN 256
>TRAF7_MOUSE (Q922B6) E3 ubiquitin protein ligase TRAF7 (EC 6.3.2.-) (TNF| receptor-associated factor 7) Length = 594 Score = 28.5 bits (62), Expect = 7.2 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = -2 Query: 430 TIXGHIFCQKCIKASIQXXKKCPTCRRKLTI 338 T GH FC++C S +KCP KLT+ Sbjct: 68 TTCGHTFCRRCALKS----EKCPVDNAKLTV 94
>ATL1F_ARATH (Q9LQM2) Putative RING-H2 finger protein ATL1F precursor| Length = 332 Score = 28.5 bits (62), Expect = 7.2 Identities = 12/37 (32%), Positives = 18/37 (48%) Frame = -2 Query: 418 HIFCQKCIKASIQXXKKCPTCRRKLTISNFXRVYLPM 308 H F CI + K CP CRR+L + + + P+ Sbjct: 175 HSFHTICIDLWFEGHKTCPVCRRELDVEDRTSLEKPL 211
>TRI22_HUMAN (Q8IYM9) Tripartite motif protein 22 (RING finger protein 94) (50| kDa-stimulated trans-acting factor) (Staf-50) Length = 498 Score = 28.5 bits (62), Expect = 7.2 Identities = 13/37 (35%), Positives = 16/37 (43%), Gaps = 7/37 (18%) Frame = -2 Query: 421 GHIFCQKCIKASIQXX-------KKCPTCRRKLTISN 332 GH FCQ CI A I+ CP C+ + N Sbjct: 31 GHSFCQACITAKIKESVIISRGESSCPVCQTRFQPGN 67
>RN126_HUMAN (Q9BV68) RING finger protein 126| Length = 326 Score = 28.5 bits (62), Expect = 7.2 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = -2 Query: 418 HIFCQKCIKASIQXXKKCPTCRRKLTISN 332 H+F CI ++ CP CR+ LT N Sbjct: 249 HLFHDGCIVPWLEQHDSCPVCRKSLTGQN 277
>DG17_DICDI (P11467) Protein DG17| Length = 458 Score = 28.5 bits (62), Expect = 7.2 Identities = 9/23 (39%), Positives = 16/23 (69%) Frame = -2 Query: 421 GHIFCQKCIKASIQXXKKCPTCR 353 GH C++C + S++ K+C TC+ Sbjct: 45 GHHACKECWEKSLETKKECMTCK 67
>RAD18_CANAL (Q5A4N5) Postreplication repair ubiquitin-protein ligase E3 RAD18| (EC 6.-.-.-) Length = 378 Score = 28.5 bits (62), Expect = 7.2 Identities = 9/32 (28%), Positives = 17/32 (53%) Frame = -2 Query: 418 HIFCQKCIKASIQXXKKCPTCRRKLTISNFXR 323 H +C +CI+ + +CP C+ ++ S R Sbjct: 46 HTYCSQCIREFLLRDNRCPLCKTEVFESGLKR 77
>SINA4_ARATH (Q9STN8) Ubiquitin ligase SINAT4 (EC 6.3.2.-) (Seven in absentia| homolog 4) Length = 327 Score = 28.1 bits (61), Expect = 9.4 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -2 Query: 421 GHIFCQKCIKASIQXXKKCPTCRRKL 344 GH C C ++ +CPTCR++L Sbjct: 81 GHTLCSTC---KVRVHNRCPTCRQEL 103
>DP2L_METJA (Q59024) DNA polymerase II large subunit (EC 2.7.7.7) (Pol II)| Length = 1139 Score = 28.1 bits (61), Expect = 9.4 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -2 Query: 409 CQKCIKASIQXXKKCPTCRRKLTISNFXRVYLPM 308 C C K S+ + CP C K+ + NF R+ P+ Sbjct: 669 CPNCGKISLY--RVCPFCGTKVELDNFGRIKAPL 700 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 56,856,533 Number of Sequences: 219361 Number of extensions: 1028486 Number of successful extensions: 2245 Number of sequences better than 10.0: 109 Number of HSP's better than 10.0 without gapping: 2170 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2225 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 2453576370 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)