| Clone Name | rbaal5m23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | QORH_ARATH (Q9SV68) Putative chloroplastic quinone-oxidoreductas... | 50 | 2e-06 | 2 | QORH_SPIOL (Q8H0M1) Chloroplastic quinone-oxidoreductase homolog... | 42 | 3e-04 | 3 | RNBP6_HUMAN (O60518) Ran-binding protein 6 (RanBP6) | 28 | 5.2 | 4 | RNBP6_MOUSE (Q8BIV3) Ran-binding protein 6 (RanBP6) (Fragment) | 28 | 5.2 | 5 | COKA1_MOUSE (Q923P0) Collagen alpha-1(XX) chain (Fragment) | 28 | 8.9 |
|---|
>QORH_ARATH (Q9SV68) Putative chloroplastic quinone-oxidoreductase homolog (EC| 1.-.-.-) Length = 329 Score = 50.1 bits (118), Expect = 2e-06 Identities = 25/42 (59%), Positives = 29/42 (69%) Frame = -2 Query: 168 PLLLSPNKAXLEFLVGLLKEGKLKTVIDSRFPLSDXRQGVAK 43 PLLL P LEF+V L+KEGK+KTVIDS+ PLS AK Sbjct: 274 PLLLIPKAENLEFMVNLVKEGKVKTVIDSKHPLSKAEDAWAK 315
>QORH_SPIOL (Q8H0M1) Chloroplastic quinone-oxidoreductase homolog (EC 1.-.-.-)| (ceQORH) Length = 329 Score = 42.4 bits (98), Expect = 3e-04 Identities = 21/34 (61%), Positives = 25/34 (73%) Frame = -2 Query: 168 PLLLSPNKAXLEFLVGLLKEGKLKTVIDSRFPLS 67 PLLL P E++V L+KE KLKTVIDS+ PLS Sbjct: 274 PLLLIPKIPNFEYVVNLVKEKKLKTVIDSKHPLS 307
>RNBP6_HUMAN (O60518) Ran-binding protein 6 (RanBP6)| Length = 1105 Score = 28.5 bits (62), Expect = 5.2 Identities = 11/43 (25%), Positives = 23/43 (53%) Frame = -2 Query: 168 PLLLSPNKAXLEFLVGLLKEGKLKTVIDSRFPLSDXRQGVAKQ 40 P+++ PN + L ++ ++ EGK+ I+ P + V +Q Sbjct: 1033 PVVIGPNNSNLPKIISIIAEGKINETINYEDPCAKRLANVVRQ 1075
>RNBP6_MOUSE (Q8BIV3) Ran-binding protein 6 (RanBP6) (Fragment)| Length = 439 Score = 28.5 bits (62), Expect = 5.2 Identities = 11/43 (25%), Positives = 22/43 (51%) Frame = -2 Query: 168 PLLLSPNKAXLEFLVGLLKEGKLKTVIDSRFPLSDXRQGVAKQ 40 P+++ PN + L ++ ++ EGK+ I P + V +Q Sbjct: 367 PVVIGPNNSNLPKIISIIAEGKINETISHEDPCAKRLANVVRQ 409
>COKA1_MOUSE (Q923P0) Collagen alpha-1(XX) chain (Fragment)| Length = 765 Score = 27.7 bits (60), Expect = 8.9 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -1 Query: 160 PVAQQGXPGVLGRAAQGRQAEDGDRLE 80 P QQG PG GRA QG G + E Sbjct: 555 PGGQQGSPGTQGRAVQGPMGPPGAKGE 581 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,513,833 Number of Sequences: 219361 Number of extensions: 366148 Number of successful extensions: 1418 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1271 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1418 length of database: 80,573,946 effective HSP length: 31 effective length of database: 73,773,755 effective search space used: 1770570120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)