ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | rbaal5m03 |
|---|---|
| Clone Library Name | barley_pub |
>METK_HORVU (P50299) S-adenosylmethionine synthetase 1 (EC 2.5.1.6) (Methionine| adenosyltransferase 1) (AdoMet synthetase 1) Length = 394 Score = 37.4 bits (85), Expect = 0.014 Identities = 16/16 (100%), Positives = 16/16 (100%) Frame = -2 Query: 409 FTWEVVKPLKFDKASA 362 FTWEVVKPLKFDKASA Sbjct: 379 FTWEVVKPLKFDKASA 394
>GST2_YEAST (Q12390) Glutathione S-transferase II (EC 2.5.1.18) (GST-II)| Length = 233 Score = 37.0 bits (84), Expect = 0.018 Identities = 30/113 (26%), Positives = 49/113 (43%), Gaps = 7/113 (6%) Frame = +2 Query: 17 KNVINYLFFAR--LWKKEHYEENYTTKNMRS-----ESDRGTNRANCTSLSSFRDTKRKR 175 KN+++ + F R LWK EH + + KN E D GT A CT+++ + D Sbjct: 40 KNMLSSVQFVRINLWKGEHKKPEFLAKNYSGTVPVLELDDGTLIAECTAITEYIDALDGT 99 Query: 176 GNISNDTPVRELSXDHQTARPV*HVAAMLNASSYFRGAKGSRLAELERHQTKK 334 ++ TP+ + R + + S YF A E+E +Q K+ Sbjct: 100 PTLTGKTPLEKGVIHMMNKRA--ELELLDPVSVYFHHATPGLGPEVELYQNKE 150
>METL_ORYSA (P93438) S-adenosylmethionine synthetase 2 (EC 2.5.1.6) (Methionine| adenosyltransferase 2) (AdoMet synthetase 2) Length = 394 Score = 33.5 bits (75), Expect = 0.20 Identities = 13/16 (81%), Positives = 16/16 (100%) Frame = -2 Query: 409 FTWEVVKPLKFDKASA 362 FTWEVVKPLK++KAS+ Sbjct: 379 FTWEVVKPLKYEKASS 394
>METL_CATRO (Q96552) S-adenosylmethionine synthetase 2 (EC 2.5.1.6) (Methionine| adenosyltransferase 2) (AdoMet synthetase 2) Length = 393 Score = 32.7 bits (73), Expect = 0.34 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 409 FTWEVVKPLKFDKASA 362 FTWEVVKPLKF+K A Sbjct: 378 FTWEVVKPLKFEKVEA 393
>METK_ORYSA (P46611) S-adenosylmethionine synthetase 1 (EC 2.5.1.6) (Methionine| adenosyltransferase 1) (AdoMet synthetase 1) Length = 396 Score = 32.0 bits (71), Expect = 0.58 Identities = 13/16 (81%), Positives = 15/16 (93%) Frame = -2 Query: 409 FTWEVVKPLKFDKASA 362 FTWEVVKPLK++K SA Sbjct: 381 FTWEVVKPLKWEKPSA 396
>METL_LYCES (P43281) S-adenosylmethionine synthetase 2 (EC 2.5.1.6) (Methionine| adenosyltransferase 2) (AdoMet synthetase 2) Length = 393 Score = 32.0 bits (71), Expect = 0.58 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 409 FTWEVVKPLKFDKASA 362 FTWEVVKPLK+DK A Sbjct: 378 FTWEVVKPLKWDKPEA 393
>METL_ARATH (P17562) S-adenosylmethionine synthetase 2 (EC 2.5.1.6) (Methionine| adenosyltransferase 2) (AdoMet synthetase 2) Length = 393 Score = 32.0 bits (71), Expect = 0.58 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 409 FTWEVVKPLKFDKASA 362 FTWEVVKPLK+DK A Sbjct: 378 FTWEVVKPLKWDKPQA 393
>METK_BRAJU (P49611) S-adenosylmethionine synthetase (EC 2.5.1.6) (Methionine| adenosyltransferase) (AdoMet synthetase) Length = 393 Score = 32.0 bits (71), Expect = 0.58 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 409 FTWEVVKPLKFDKASA 362 FTWEVVKPLK+DK A Sbjct: 378 FTWEVVKPLKWDKPQA 393
>METK_ARATH (P23686) S-adenosylmethionine synthetase 1 (EC 2.5.1.6) (Methionine| adenosyltransferase 1) (AdoMet synthetase 1) Length = 393 Score = 32.0 bits (71), Expect = 0.58 Identities = 13/16 (81%), Positives = 14/16 (87%) Frame = -2 Query: 409 FTWEVVKPLKFDKASA 362 FTWEVVKPLK+DK A Sbjct: 378 FTWEVVKPLKWDKPQA 393
>METK_CATRO (Q96551) S-adenosylmethionine synthetase 1 (EC 2.5.1.6) (Methionine| adenosyltransferase 1) (AdoMet synthetase 1) Length = 393 Score = 31.2 bits (69), Expect = 0.99 Identities = 12/15 (80%), Positives = 15/15 (100%) Frame = -2 Query: 409 FTWEVVKPLKFDKAS 365 FTWEVVKPLK++KA+ Sbjct: 378 FTWEVVKPLKWEKAA 392
>METL_PETCR (P31156) S-adenosylmethionine synthetase 2 (EC 2.5.1.6) (Methionine| adenosyltransferase 2) (AdoMet synthetase 2) (Fragment) Length = 145 Score = 30.8 bits (68), Expect = 1.3 Identities = 12/14 (85%), Positives = 14/14 (100%) Frame = -2 Query: 409 FTWEVVKPLKFDKA 368 FTWEVVKPLK++KA Sbjct: 132 FTWEVVKPLKWEKA 145
>METK_PEA (P49612) S-adenosylmethionine synthetase 1 (EC 2.5.1.6) (Methionine| adenosyltransferase 1) (AdoMet synthetase 1) (Fragment) Length = 366 Score = 30.8 bits (68), Expect = 1.3 Identities = 12/14 (85%), Positives = 14/14 (100%) Frame = -2 Query: 409 FTWEVVKPLKFDKA 368 FTWEVVKPLK++KA Sbjct: 353 FTWEVVKPLKWEKA 366
>METK_PETCR (P31155) S-adenosylmethionine synthetase 1 (EC 2.5.1.6) (Methionine| adenosyltransferase 1) (AdoMet synthetase 1) (Fragment) Length = 234 Score = 30.8 bits (68), Expect = 1.3 Identities = 12/14 (85%), Positives = 14/14 (100%) Frame = -2 Query: 409 FTWEVVKPLKFDKA 368 FTWEVVKPLK++KA Sbjct: 221 FTWEVVKPLKWEKA 234
>METK_PINBN (P50300) S-adenosylmethionine synthetase (EC 2.5.1.6) (Methionine| adenosyltransferase) (AdoMet synthetase) Length = 393 Score = 30.8 bits (68), Expect = 1.3 Identities = 12/16 (75%), Positives = 14/16 (87%) Frame = -2 Query: 409 FTWEVVKPLKFDKASA 362 FTWE VKPLK++KA A Sbjct: 378 FTWETVKPLKWEKAQA 393
>PDXA_CAMJE (Q9PN58) 4-hydroxythreonine-4-phosphate dehydrogenase (EC| 1.1.1.262) (4-(phosphohydroxy)-L-threonine dehydrogenase) Length = 364 Score = 30.4 bits (67), Expect = 1.7 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +2 Query: 179 NISNDTPVRELSXDHQTARPV*HVAAMLNASSYFRGAK 292 N+S + P+ +S DH TA + A +N SYF AK Sbjct: 318 NVSLNLPIIRVSVDHGTAFDKAYKNAKINTKSYFEAAK 355
>METK_MESCR (P93254) S-adenosylmethionine synthetase (EC 2.5.1.6) (Methionine| adenosyltransferase) (AdoMet synthetase) Length = 392 Score = 29.3 bits (64), Expect = 3.7 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -2 Query: 409 FTWEVVKPLKFDK 371 FTWEVVKPLK++K Sbjct: 377 FTWEVVKPLKWEK 389
>METM_ACTCH (P50303) S-adenosylmethionine synthetase 3 (EC 2.5.1.6) (Methionine| adenosyltransferase 3) (AdoMet synthetase 3) (Fragment) Length = 360 Score = 29.3 bits (64), Expect = 3.7 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -2 Query: 409 FTWEVVKPLKFDK 371 FTWEVVKPLK++K Sbjct: 345 FTWEVVKPLKWEK 357
>METK_LYCES (P43280) S-adenosylmethionine synthetase 1 (EC 2.5.1.6) (Methionine| adenosyltransferase 1) (AdoMet synthetase 1) Length = 393 Score = 29.3 bits (64), Expect = 3.7 Identities = 11/13 (84%), Positives = 13/13 (100%) Frame = -2 Query: 409 FTWEVVKPLKFDK 371 FTWEVVKPLK++K Sbjct: 378 FTWEVVKPLKWEK 390
>HBA_CAICR (P02000) Hemoglobin alpha subunit (Hemoglobin alpha chain)| (Alpha-globin) Length = 141 Score = 28.9 bits (63), Expect = 4.9 Identities = 16/51 (31%), Positives = 31/51 (60%), Gaps = 2/51 (3%) Frame = +2 Query: 251 AAMLNASSYFRGAKGS--RLAELERHQTKKNPQCDVLFLSRCLVELEGLHH 397 AA+ +A ++ G+ RL++L H + +P + FLS+C++ + G+HH Sbjct: 64 AALHDAVNHIDDLAGALCRLSDLHAHNLRVDP-VNFKFLSQCILVVFGVHH 113
>METK_POPDE (P47916) S-adenosylmethionine synthetase (EC 2.5.1.6) (Methionine| adenosyltransferase) (AdoMet synthetase) Length = 395 Score = 28.9 bits (63), Expect = 4.9 Identities = 11/12 (91%), Positives = 12/12 (100%) Frame = -2 Query: 409 FTWEVVKPLKFD 374 FTWEVVKPLK+D Sbjct: 379 FTWEVVKPLKWD 390
>METK_MUSAC (O22338) S-adenosylmethionine synthetase (EC 2.5.1.6) (Methionine| adenosyltransferase) (AdoMet synthetase) Length = 393 Score = 28.9 bits (63), Expect = 4.9 Identities = 11/16 (68%), Positives = 14/16 (87%) Frame = -2 Query: 409 FTWEVVKPLKFDKASA 362 FTWEVVKPL+ +K +A Sbjct: 378 FTWEVVKPLELEKPAA 393
>POU1_DUGJA (P31370) POU domain protein 1 (DjPOU1)| Length = 559 Score = 28.5 bits (62), Expect = 6.4 Identities = 10/21 (47%), Positives = 17/21 (80%) Frame = +2 Query: 134 CTSLSSFRDTKRKRGNISNDT 196 C++L+S+ DT ++ GN+ NDT Sbjct: 89 CSTLNSYFDTNQRFGNVPNDT 109
>Y976_LEPIC (Q72TP1) UPF0176 protein LIC_10976| Length = 367 Score = 28.1 bits (61), Expect = 8.3 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 10/45 (22%) Frame = +2 Query: 305 AELERHQTKKNPQCDVLFL----------SRCLVELEGLHHLPGE 409 A+ +RH +NP C VLF+ C +E + + HLP E Sbjct: 285 AKCDRHVNCENPGCHVLFIQCPSCSEKFEGCCTLECQNVLHLPKE 329
>Y3128_LEPIN (Q8CXS1) UPF0176 protein LA_3128| Length = 367 Score = 28.1 bits (61), Expect = 8.3 Identities = 15/45 (33%), Positives = 22/45 (48%), Gaps = 10/45 (22%) Frame = +2 Query: 305 AELERHQTKKNPQCDVLFL----------SRCLVELEGLHHLPGE 409 A+ +RH +NP C VLF+ C +E + + HLP E Sbjct: 285 AKCDRHVNCENPGCHVLFIQCPSCSEKFEGCCTLECQNVLHLPKE 329
>ENV_HV2SB (P12449) Envelope polyprotein GP160 precursor [Contains: Exterior| membrane glycoprotein (GP120); Transmembrane glycoprotein (GP41)] Length = 846 Score = 28.1 bits (61), Expect = 8.3 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +2 Query: 56 KKEHYEENYTTKNMRSESDRGTNRANC 136 KK+ Y E + +K++ ESD T+R C Sbjct: 165 KKKQYSETWYSKDVVCESDNSTDRKRC 191
>CDC27_HUMAN (P30260) Cell division cycle protein 27 homolog (CDC27Hs) (H-NUC)| Length = 824 Score = 28.1 bits (61), Expect = 8.3 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +2 Query: 251 AAMLNASSYFRGAKGSRLAELERHQTKKNPQCDVLFLSRCLVELEGL 391 A L A+ Y+R K + L + + PQC L L++C V+L L Sbjct: 40 ALFLLATCYYRSGKAYKAYRLLKGHSCTTPQCKYL-LAKCCVDLSKL 85 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 49,330,951 Number of Sequences: 219361 Number of extensions: 783709 Number of successful extensions: 1979 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 1944 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1976 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
