| Clone Name | rbaal5m02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PACC_CANAL (Q9UW14) pH-response transcription factor pacC/RIM101... | 30 | 1.8 | 2 | PACC_DEBHA (Q6BSZ4) pH-response transcription factor pacC/RIM101 | 30 | 2.3 | 3 | PUB3_SCHPO (O14326) E3 ubiquitin--protein ligase pub3 (EC 6.3.2.-) | 28 | 5.2 | 4 | LAC1_MELAO (Q70KY3) Laccase-1 precursor (EC 1.10.3.2) (Benzenedi... | 28 | 6.8 |
|---|
>PACC_CANAL (Q9UW14) pH-response transcription factor pacC/RIM101 (pH-response| regulator protein 2) Length = 661 Score = 30.0 bits (66), Expect = 1.8 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +3 Query: 51 HAALFSSMKPFLIAIAPQSLRQPKANKNHSFTGADD 158 H + +KPF + P+S ++P+ K HS T A+D Sbjct: 264 HLRVHVPLKPFHCDLCPKSFKRPQDLKKHSKTHAED 299
>PACC_DEBHA (Q6BSZ4) pH-response transcription factor pacC/RIM101| Length = 617 Score = 29.6 bits (65), Expect = 2.3 Identities = 13/36 (36%), Positives = 20/36 (55%) Frame = +3 Query: 51 HAALFSSMKPFLIAIAPQSLRQPKANKNHSFTGADD 158 H + +KPF + P+S ++P+ K HS ADD Sbjct: 219 HLRVHVPLKPFHCDVCPKSFKRPQDLKKHSKIHADD 254
>PUB3_SCHPO (O14326) E3 ubiquitin--protein ligase pub3 (EC 6.3.2.-)| Length = 786 Score = 28.5 bits (62), Expect = 5.2 Identities = 16/53 (30%), Positives = 27/53 (50%) Frame = +3 Query: 15 RQSNLTREVSQ*HAALFSSMKPFLIAIAPQSLRQPKANKNHSFTGADDESXTP 173 R+ +LTR + + S + ++ +AP +R P NHS T A+ + TP Sbjct: 103 REVSLTRPLKKSSTTNLSVLGNLVLKVAPSKIRAPAG--NHSSTTANRTTSTP 153
>LAC1_MELAO (Q70KY3) Laccase-1 precursor (EC 1.10.3.2) (Benzenediol:oxygen| oxidoreductase) (Urishiol oxidase) (Ligninolytic phenoloxidase) Length = 623 Score = 28.1 bits (61), Expect = 6.8 Identities = 12/24 (50%), Positives = 14/24 (58%) Frame = -3 Query: 169 VXDSSSAPVNEWFLFAFGWRKDCG 98 V D+S AP N WF FG + CG Sbjct: 326 VIDASRAPDNYWFNVTFGGQAACG 349 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,461,261 Number of Sequences: 219361 Number of extensions: 283390 Number of successful extensions: 670 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 669 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 670 length of database: 80,573,946 effective HSP length: 33 effective length of database: 73,335,033 effective search space used: 1760040792 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)