| Clone Name | rbaal6a23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RHAAB_BACSK (Q5WL39) RhaA/rhaB bifunctional enzyme [Includes: Rh... | 30 | 2.7 | 2 | DMWD_MOUSE (Q08274) Dystrophia myotonica WD repeat-containing pr... | 29 | 4.6 | 3 | KHSE_SULTO (Q975A7) Homoserine kinase (EC 2.7.1.39) (HSK) (HK) | 28 | 7.9 |
|---|
>RHAAB_BACSK (Q5WL39) RhaA/rhaB bifunctional enzyme [Includes: Rhamnulokinase| (EC 2.7.1.5) (Rhamnulose kinase); L-rhamnose isomerase (EC 5.3.1.14)] Length = 894 Score = 30.0 bits (66), Expect = 2.7 Identities = 21/53 (39%), Positives = 23/53 (43%) Frame = -1 Query: 288 RRAVRLAKAVTYIWPHSRELHQSSRGIGVAIXRS*CGTSVGAAFHRVN*HPES 130 R VR A VTY P E H SSR + G V AAF +V P S Sbjct: 451 RALVRTAFPVTYFLPQRSESHVSSRFESAKVQYEQLGIDVEAAFAKVKQVPIS 503
>DMWD_MOUSE (Q08274) Dystrophia myotonica WD repeat-containing protein| (Dystrophia myotonica-containing WD repeat motif protein) (DMR-N9 protein) Length = 650 Score = 29.3 bits (64), Expect = 4.6 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -2 Query: 353 FSPSGRHVLCIGKDGSL 303 FSP GRH+ C+ +DG L Sbjct: 274 FSPDGRHLACVSQDGCL 290
>KHSE_SULTO (Q975A7) Homoserine kinase (EC 2.7.1.39) (HSK) (HK)| Length = 306 Score = 28.5 bits (62), Expect = 7.9 Identities = 15/31 (48%), Positives = 20/31 (64%) Frame = -3 Query: 430 N*IERLXSSRRILVSVGIR*SICSSGSPHQD 338 N I +L SR+ LV+ ++ I SSGSPH D Sbjct: 104 NEIFKLNLSRQELVNFAMKGEIASSGSPHPD 134 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 63,384,109 Number of Sequences: 219361 Number of extensions: 1217036 Number of successful extensions: 2092 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2068 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2092 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2677159704 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)