| Clone Name | rbaal6a12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | EMS_DROME (P18488) Homeotic protein empty spiracles | 32 | 2.4 | 2 | RHAAB_BACSK (Q5WL39) RhaA/rhaB bifunctional enzyme [Includes: Rh... | 31 | 4.1 |
|---|
>EMS_DROME (P18488) Homeotic protein empty spiracles| Length = 497 Score = 31.6 bits (70), Expect = 2.4 Identities = 18/55 (32%), Positives = 24/55 (43%), Gaps = 2/55 (3%) Frame = +1 Query: 460 PFYSVAPPAHQPPMPWRHPRLS*LSHLALRPSHPRWFSWLSQL--SHLVLQPWHP 618 P + +APPAH P P H + HL HP + HL++Q HP Sbjct: 80 PHHLMAPPAHGLPYPHPHAQQQQQQHLQAPHPHPHLSPAQQHVLHQHLLMQHQHP 134
>RHAAB_BACSK (Q5WL39) RhaA/rhaB bifunctional enzyme [Includes: Rhamnulokinase| (EC 2.7.1.5) (Rhamnulose kinase); L-rhamnose isomerase (EC 5.3.1.14)] Length = 894 Score = 30.8 bits (68), Expect = 4.1 Identities = 21/53 (39%), Positives = 24/53 (45%) Frame = -2 Query: 332 RRAVRLAKAVTYIWPHSRELHQSSRGIGVAIKRS*CGTSVGAAFHRVN*HPES 174 R VR A VTY P E H SSR ++ G V AAF +V P S Sbjct: 451 RALVRTAFPVTYFLPQRSESHVSSRFESAKVQYEQLGIDVEAAFAKVKQVPIS 503 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 96,252,845 Number of Sequences: 219361 Number of extensions: 1996242 Number of successful extensions: 4652 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4446 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4650 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 6856295237 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)