| Clone Name | rbaal5l09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ATE_BRUSU (P63647) Putative arginyl-tRNA--protein transferase (E... | 29 | 2.9 | 2 | ATE_BRUME (P63646) Putative arginyl-tRNA--protein transferase (E... | 29 | 2.9 | 3 | ADP1_MYCPN (P11311) Adhesin P1 precursor (Cytadhesin P1) (Attach... | 29 | 3.8 | 4 | Y11K_TYDVA (P31619) Hypothetical 11.2 kDa protein | 28 | 8.5 |
|---|
>ATE_BRUSU (P63647) Putative arginyl-tRNA--protein transferase (EC 2.3.2.8)| (R-transferase) (Arginyltransferase) Length = 249 Score = 29.3 bits (64), Expect = 2.9 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +3 Query: 99 FSP*KQQR*KGPYNFLEYSFSSRASGTPSLYL 194 FSP Q+R G Y L++ +RA+G P +YL Sbjct: 186 FSPHMQERSLGTYMILDHIERARAAGLPHVYL 217
>ATE_BRUME (P63646) Putative arginyl-tRNA--protein transferase (EC 2.3.2.8)| (R-transferase) (Arginyltransferase) Length = 249 Score = 29.3 bits (64), Expect = 2.9 Identities = 14/32 (43%), Positives = 20/32 (62%) Frame = +3 Query: 99 FSP*KQQR*KGPYNFLEYSFSSRASGTPSLYL 194 FSP Q+R G Y L++ +RA+G P +YL Sbjct: 186 FSPHMQERSLGTYMILDHIERARAAGLPHVYL 217
>ADP1_MYCPN (P11311) Adhesin P1 precursor (Cytadhesin P1) (Attachment protein)| Length = 1627 Score = 28.9 bits (63), Expect = 3.8 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = +2 Query: 26 LQLFVPDQAIL*RNLGKILPELGKFLPMKTTKVKGP 133 L+ F PDQ N ++ P G FLP+ T +GP Sbjct: 1474 LEFFKPDQDTQPNNNVQVNPNNGDFLPLLTASSQGP 1509
>Y11K_TYDVA (P31619) Hypothetical 11.2 kDa protein| Length = 102 Score = 27.7 bits (60), Expect = 8.5 Identities = 13/50 (26%), Positives = 26/50 (52%) Frame = -3 Query: 161 TKRIFKKIVRALLPLLFSWGEICPVLAIFCPSFFRVLPDQEQRVADKIAF 12 ++ F K+V AL+ +LF+ G + +F +L ++Q+ +I F Sbjct: 35 SEHFFSKVVVALIVILFAVGIVYLAYTLFLKDLILLLKAKKQKTTTEIGF 84 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,971,006 Number of Sequences: 219361 Number of extensions: 521528 Number of successful extensions: 1363 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1316 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1363 length of database: 80,573,946 effective HSP length: 46 effective length of database: 70,483,340 effective search space used: 1691600160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)