| Clone Name | rbaal6a07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SUS1_SOLTU (P10691) Sucrose synthase (EC 2.4.1.13) (Sucrose-UDP ... | 30 | 5.6 | 2 | SUS1_DAUCA (P49035) Sucrose synthase isoform I (EC 2.4.1.13) (Su... | 29 | 9.5 |
|---|
>SUS1_SOLTU (P10691) Sucrose synthase (EC 2.4.1.13) (Sucrose-UDP| glucosyltransferase) (SS16) Length = 805 Score = 29.6 bits (65), Expect = 5.6 Identities = 23/67 (34%), Positives = 36/67 (53%) Frame = +1 Query: 259 DVGCHRCQLLPGLPSHALERGQVLSGLEGDSVDQIRSTQIGIRIVRLLAKQIST*NGQRI 438 D G +L +P ALER ++L ++ +D I I + RLL + T GQRI Sbjct: 298 DTGGQVVYILDQVP--ALER-EMLKRIKEQGLDIIPRILI---VTRLLPDAVGTTCGQRI 351 Query: 439 QRIFGAE 459 ++++GAE Sbjct: 352 EKVYGAE 358
>SUS1_DAUCA (P49035) Sucrose synthase isoform I (EC 2.4.1.13) (Sucrose-UDP| glucosyltransferase 1) (Susy*Dc1) Length = 808 Score = 28.9 bits (63), Expect = 9.5 Identities = 27/110 (24%), Positives = 45/110 (40%), Gaps = 8/110 (7%) Frame = +1 Query: 154 EQIHHLLSCPNNQERPTAEDLLCKFSSEDPIKIRYDVGCHRCQLLPGLPSHALERGQVLS 333 E H LL + T E L K + I G + + G P + +L Sbjct: 251 EMFHMLLDLLEAPDASTLETFLGKIPMVFNVVILSPHGYFAQENVLGYPDTGGQVVYILD 310 Query: 334 ---GLEGDSVDQIRSTQIGIR-----IVRLLAKQIST*NGQRIQRIFGAE 459 LE + + +I+ + I+ + RLL + T QR++++FGAE Sbjct: 311 QVPALEREMIKRIKEQGLDIKPRILIVTRLLPDAVGTTCNQRLEKVFGAE 360 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 77,468,368 Number of Sequences: 219361 Number of extensions: 1562419 Number of successful extensions: 3435 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3377 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3435 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4200495993 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)