| Clone Name | rbaal5f02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NOTC4_HUMAN (Q99466) Neurogenic locus notch homolog protein 4 pr... | 30 | 4.9 | 2 | OBSCN_HUMAN (Q5VST9) Obscurin (Obscurin-myosin light chain kinas... | 30 | 6.4 |
|---|
>NOTC4_HUMAN (Q99466) Neurogenic locus notch homolog protein 4 precursor (Notch 4)| (hNotch4) [Contains: Notch 4 extracellular truncation; Notch 4 intracellular domain] Length = 2003 Score = 30.4 bits (67), Expect = 4.9 Identities = 23/64 (35%), Positives = 31/64 (48%), Gaps = 6/64 (9%) Frame = +2 Query: 377 PKPLGCSPTHRGVEALAV------ELVRSRARRHGSTRLAKGGAQAGRTGASGAWADPAE 538 P P+ CSP GV LA+ +L+R R R HG+ L G + RT ++ P Sbjct: 1446 PWPVLCSPV-AGVILLALGALLVLQLIRRRRREHGALWLPPGFTRRPRTQSAPHRRRPPL 1504 Query: 539 GADS 550 G DS Sbjct: 1505 GEDS 1508
>OBSCN_HUMAN (Q5VST9) Obscurin (Obscurin-myosin light chain kinase)| (Obscurin-MLCK) (Obscurin-RhoGEF) Length = 7968 Score = 30.0 bits (66), Expect = 6.4 Identities = 14/58 (24%), Positives = 33/58 (56%) Frame = +3 Query: 228 GNDSNGI*GNGHLACDLAWKKNESVKQTKQHSRANPHAPKRFVTRSGFQTPNPSVAVQ 401 G D+ G+ G G + +AW ++S ++ ++ +RA + ++ R+ ++P P V+ + Sbjct: 7197 GGDAGGMLGQGPMWARIAWAVSQSEEEEQEEARAESQSEEQQEARA--ESPLPQVSAR 7252 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 79,783,109 Number of Sequences: 219361 Number of extensions: 1483435 Number of successful extensions: 3958 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3845 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3954 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6314008338 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)