| Clone Name | rbaal4p20 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YKQ8_CAEEL (P34303) Putative zinc finger protein C06E1.8 | 29 | 3.4 | 2 | Y302_ENCCU (Q8SW84) Hypothetical protein ECU03_0020 | 28 | 7.7 | 3 | Y503_ENCCU (Q8ST70) Hypothetical protein ECU05_0030/ECU10_1870 | 28 | 7.7 | 4 | M4A6A_HUMAN (Q9H2W1) Membrane-spanning 4-domains subfamily A mem... | 28 | 7.7 | 5 | NPC2_CAEEL (P34389) Niemann-Pick C1 protein homolog 2 precursor | 28 | 7.7 |
|---|
>YKQ8_CAEEL (P34303) Putative zinc finger protein C06E1.8| Length = 397 Score = 28.9 bits (63), Expect = 3.4 Identities = 18/67 (26%), Positives = 30/67 (44%), Gaps = 3/67 (4%) Frame = -3 Query: 200 CMHACMHSSLLSAKD*FKYHMLHQLLHFTEPILQNKDIRTIL---HHIMRIVVCHSCNNV 30 C HSS LS + ++ + I ++ +RT + HHI R+ +C CN Sbjct: 56 CSKVFCHSSSLSRHRMQAHFKSYKCTVCRKDISSSESLRTHMFKQHHISRMYMCRCCNWA 115 Query: 29 YKSPSIL 9 + S+L Sbjct: 116 FPDKSLL 122
>Y302_ENCCU (Q8SW84) Hypothetical protein ECU03_0020| Length = 269 Score = 27.7 bits (60), Expect = 7.7 Identities = 17/66 (25%), Positives = 32/66 (48%), Gaps = 2/66 (3%) Frame = -1 Query: 229 IRYLLRSWKHAC--MHACILPSYRQRINLSTTCYISYFILPSLFCKTRTYVRFYTTLCAL 56 I + L W HA + +LPS+ + + SYF++P T T + ++C++ Sbjct: 119 IPFSLNEWDHAASFFYPIVLPSFT--VPPAYLLSSSYFLVPRQIRLTDTVISILISVCSI 176 Query: 55 SSVIHV 38 +V+ V Sbjct: 177 VNVLLV 182
>Y503_ENCCU (Q8ST70) Hypothetical protein ECU05_0030/ECU10_1870| Length = 489 Score = 27.7 bits (60), Expect = 7.7 Identities = 17/66 (25%), Positives = 32/66 (48%), Gaps = 2/66 (3%) Frame = -1 Query: 229 IRYLLRSWKHAC--MHACILPSYRQRINLSTTCYISYFILPSLFCKTRTYVRFYTTLCAL 56 I + L W HA + +LPS+ + + SYF++P T T + ++C++ Sbjct: 339 IPFSLNEWDHAASFFYPIVLPSFT--VPPAYLLSSSYFLVPRQIRLTDTVISILISVCSI 396 Query: 55 SSVIHV 38 +V+ V Sbjct: 397 VNVLLV 402
>M4A6A_HUMAN (Q9H2W1) Membrane-spanning 4-domains subfamily A member 6A| (Four-span transmembrane protein 3) (CD20 antigen-like 3) Length = 248 Score = 27.7 bits (60), Expect = 7.7 Identities = 19/78 (24%), Positives = 36/78 (46%), Gaps = 1/78 (1%) Frame = -1 Query: 256 SMAHVLREQIRYLLRSWKHACMHACILPSYRQRINLSTTCYISYFILPSLFCKTRTYVRF 77 S+ L + +++ S K A ++ L + N+ T Y+SYF SL+ Sbjct: 121 SILSALSALVGFIILSVKQATLNPASLQCELDKNNIPTRSYVSYFYHDSLYT-----TDC 175 Query: 76 YTTLCALSSVIH-VIMCT 26 YT +L+ + +++CT Sbjct: 176 YTAKASLAGTLSLMLICT 193
>NPC2_CAEEL (P34389) Niemann-Pick C1 protein homolog 2 precursor| Length = 1274 Score = 27.7 bits (60), Expect = 7.7 Identities = 17/60 (28%), Positives = 26/60 (43%), Gaps = 7/60 (11%) Frame = -1 Query: 193 MHACILPSYRQRINLSTTCY-------ISYFILPSLFCKTRTYVRFYTTLCALSSVIHVI 35 +++ P Y Q + LSTT Y F+ SLF + T LSS +H++ Sbjct: 1064 VYSTFFPYYEQYLTLSTTVYTLVVLVLFVAFVTISLFLRVNLAGSLVTVFVLLSSYLHLM 1123 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 43,143,657 Number of Sequences: 219361 Number of extensions: 795095 Number of successful extensions: 1793 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1753 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1791 length of database: 80,573,946 effective HSP length: 77 effective length of database: 63,683,149 effective search space used: 1528395576 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)