| Clone Name | rbaal4o09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HMB1_TRIGR (P09080) Homeobox protein HB1 (TGHBOX1) (Fragment) | 30 | 7.2 | 2 | SOX3_MOUSE (P53784) Transcription factor SOX-3 | 30 | 9.4 | 3 | GUAC_LACAC (Q5FHY3) GMP reductase (EC 1.7.1.7) (Guanosine 5'-mon... | 30 | 9.4 | 4 | Y681_PYRAE (Q8ZYP4) UPF0179 protein PAE0681 | 30 | 9.4 |
|---|
>HMB1_TRIGR (P09080) Homeobox protein HB1 (TGHBOX1) (Fragment)| Length = 307 Score = 30.0 bits (66), Expect = 7.2 Identities = 15/43 (34%), Positives = 24/43 (55%), Gaps = 2/43 (4%) Frame = -3 Query: 496 ASGLGKQRFRGRLTA--AGSSLYVHTTSTVSRDHLGRLFSPCK 374 A+ LG +RGR+ A AG+ V + + +H ++ SPCK Sbjct: 126 AAELGDGSYRGRVNALAAGTGCLVSAAAEPNNNHCSQVMSPCK 168
>SOX3_MOUSE (P53784) Transcription factor SOX-3| Length = 375 Score = 29.6 bits (65), Expect = 9.4 Identities = 20/56 (35%), Positives = 26/56 (46%), Gaps = 6/56 (10%) Frame = -2 Query: 308 WPPAAYELN*ILMRQDGTSQSQHAPALSSPLPTDGLPLLHYY------YFPSLPTG 159 W AY L + Q G +Q P++SSP P LP +H Y Y P +P G Sbjct: 196 WANGAYSL---VQEQLGYAQP---PSMSSPPPPPALPQMHRYDMAGLQYSPMMPPG 245
>GUAC_LACAC (Q5FHY3) GMP reductase (EC 1.7.1.7) (Guanosine 5'-monophosphate| oxidoreductase) (Guanosine monophosphate reductase) Length = 330 Score = 29.6 bits (65), Expect = 9.4 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = +2 Query: 407 TGYCTGGMYVQARACCCEPASEPLLAQSG 493 TG+ TGG + A C + AS+PL+A G Sbjct: 186 TGFGTGGWQLAALRMCSKVASKPLIADGG 214
>Y681_PYRAE (Q8ZYP4) UPF0179 protein PAE0681| Length = 167 Score = 29.6 bits (65), Expect = 9.4 Identities = 9/17 (52%), Positives = 14/17 (82%) Frame = +2 Query: 629 YLLPPECQDCQWWPVCM 679 + +P EC+DC+ +PVCM Sbjct: 22 FSIPEECKDCRLYPVCM 38 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 99,553,985 Number of Sequences: 219361 Number of extensions: 2046756 Number of successful extensions: 5658 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5352 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5653 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7139613222 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)