| Clone Name | rbaal4n17 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PCQAP_HUMAN (Q96RN5) Positive cofactor 2 glutamine/Q-rich-associ... | 30 | 3.5 | 2 | DMBT1_MOUSE (Q60997) Deleted in malignant brain tumors 1 protein... | 29 | 7.8 |
|---|
>PCQAP_HUMAN (Q96RN5) Positive cofactor 2 glutamine/Q-rich-associated protein| (PC2 glutamine/Q-rich-associated protein) (TPA-inducible gene 1 protein) (TIG-1) (Activator-recruited cofactor 105 kDa component) (ARC105) (CTG repeat protein 7a) Length = 788 Score = 30.4 bits (67), Expect = 3.5 Identities = 18/62 (29%), Positives = 30/62 (48%), Gaps = 3/62 (4%) Frame = +1 Query: 265 SEATTPRINVVNAAQNHLRPPKPNVLPISWNEPSFGLTHEED*RRRSRANLLPA---YDS 435 S+A ++ ++ Q+H PP+P P++ N+PS + S+A LP Y Sbjct: 283 SQALPQQLQQMHHTQHHQPPPQPQQPPVAQNQPSQLPPQSQTQPLVSQAQALPGQMLYTQ 342 Query: 436 PP 441 PP Sbjct: 343 PP 344
>DMBT1_MOUSE (Q60997) Deleted in malignant brain tumors 1 protein precursor| (CRP-ductin) (Vomeroglandin) Length = 2085 Score = 29.3 bits (64), Expect = 7.8 Identities = 19/52 (36%), Positives = 21/52 (40%) Frame = -3 Query: 432 VICWKKVSSRSTPLVLFVC*SKGWFVPGNRKNVWFWRTEMVLCGIDDVYAGR 277 VIC SS TP GW+ PG N F+ TE G D A R Sbjct: 283 VICSASQSSSPTP---------GWWNPGGTNNDVFYPTEQTTAGTDSGLAVR 325 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 74,785,678 Number of Sequences: 219361 Number of extensions: 1481082 Number of successful extensions: 3318 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3231 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3318 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4528412720 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)