| Clone Name | rbaal5c01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PPO_MALDO (P43309) Polyphenol oxidase, chloroplast precursor (EC... | 28 | 9.1 |
|---|
>PPO_MALDO (P43309) Polyphenol oxidase, chloroplast precursor (EC 1.10.3.1)| (PPO) (Catechol oxidase) Length = 593 Score = 27.7 bits (60), Expect = 9.1 Identities = 14/31 (45%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Frame = -3 Query: 140 DSIYIYV*FP-F*FSPHSRYLCFPFHFYYVY 51 D Y V FP H+ +L FPFH YY+Y Sbjct: 180 DGAYDQVGFPELELQIHNSWLFFPFHRYYLY 210 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 14,406,014 Number of Sequences: 219361 Number of extensions: 152933 Number of successful extensions: 514 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 501 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 513 length of database: 80,573,946 effective HSP length: 22 effective length of database: 75,748,004 effective search space used: 1817952096 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)