| Clone Name | rbaal5a22 |
|---|---|
| Clone Library Name | barley_pub |
>SCC12_ARATH (Q9FQ20) Sister chromatid cohesion 1 protein 2 (SCC1 homolog 2)| (AtRAD21-1) Length = 810 Score = 47.0 bits (110), Expect = 3e-05 Identities = 20/44 (45%), Positives = 34/44 (77%) Frame = -2 Query: 484 LVHGKTRKEASRMFFETLVLSTKDYIQVEQVNPFDLINVKPVSK 353 L G+T+KE++R+F+ETLVL TK Y++V+Q +P+ + + VS+ Sbjct: 762 LCRGRTQKESARLFYETLVLKTKGYVEVKQNHPYSDVFLMRVSR 805
>SCC13_ARATH (Q9FQ19) Sister chromatid cohesion 1 protein 3 (SCC1 homolog 3)| (AtRAD21-2) Length = 693 Score = 41.6 bits (96), Expect = 0.001 Identities = 20/40 (50%), Positives = 29/40 (72%) Frame = -2 Query: 484 LVHGKTRKEASRMFFETLVLSTKDYIQVEQVNPFDLINVK 365 ++ GKTRK A+RMFFETLVL ++ I ++Q P+ I +K Sbjct: 643 ILAGKTRKLAARMFFETLVLKSRGLIDMQQDRPYGDIALK 682
>REC8L_MOUSE (Q8C5S7) Meiotic recombination protein REC8-like 1 (Cohesin Rec8p)| Length = 591 Score = 33.9 bits (76), Expect = 0.24 Identities = 17/38 (44%), Positives = 25/38 (65%) Frame = -2 Query: 466 RKEASRMFFETLVLSTKDYIQVEQVNPFDLINVKPVSK 353 RK ASR+F+ LVLST+ + VEQ P+ + ++P K Sbjct: 552 RKLASRVFYLLLVLSTQKILLVEQQKPYGPLLIRPGPK 589
>RAD21_SCHPO (P30776) Cohesin subunit rad21 (Double-strand-break repair protein| rad21) (SCC1 homolog) Length = 628 Score = 33.5 bits (75), Expect = 0.31 Identities = 15/27 (55%), Positives = 21/27 (77%) Frame = -2 Query: 475 GKTRKEASRMFFETLVLSTKDYIQVEQ 395 G R+EA ++FF+ LVL+TKD I V+Q Sbjct: 581 GCNREEAVQLFFDVLVLATKDVISVKQ 607
>REC8L_HUMAN (O95072) Meiotic recombination protein REC8-like 1 (Cohesin Rec8p)| Length = 547 Score = 29.3 bits (64), Expect = 5.8 Identities = 12/35 (34%), Positives = 23/35 (65%) Frame = -2 Query: 466 RKEASRMFFETLVLSTKDYIQVEQVNPFDLINVKP 362 R+ A+R+F+ LVLS + + V+Q P+ + ++P Sbjct: 508 RRMAARVFYLLLVLSAQQILHVKQEKPYGRLLIQP 542
>SUCC_CHLCV (Q822A1) Succinyl-CoA synthetase beta chain (EC 6.2.1.5) (SCS-beta)| Length = 388 Score = 28.9 bits (63), Expect = 7.6 Identities = 12/32 (37%), Positives = 22/32 (68%) Frame = -1 Query: 485 ASAWEDSERSFKDVLRDLGVVDEGLHSGGAGE 390 AS+ E+ +++ K++ D GVV +H+GG G+ Sbjct: 25 ASSVEEGQQALKELAIDAGVVKVQVHAGGRGK 56
>SCC1_YEAST (Q12158) Sister chromatid cohesion protein 1| Length = 566 Score = 28.9 bits (63), Expect = 7.6 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = -2 Query: 469 TRKEASRMFFETLVLSTKDYIQVEQVNPFDLINV 368 T++EASR FF+ L L+T+ I + Q F I + Sbjct: 520 TKREASRGFFDILSLATEGCIGLSQTEAFGNIKI 553
>RPOB_GEOSL (Q748Y6) DNA-directed RNA polymerase beta chain (EC 2.7.7.6) (RNAP| beta subunit) (Transcriptase beta chain) (RNA polymerase beta subunit) Length = 1370 Score = 28.5 bits (62), Expect = 9.9 Identities = 13/24 (54%), Positives = 17/24 (70%) Frame = -2 Query: 406 QVEQVNPFDLINVKPVSKLLKTDF 335 +VE + P DLIN KPVS ++K F Sbjct: 491 EVENLMPHDLINSKPVSAVVKEFF 514
>SYE_CORGL (Q8NQX9) Glutamyl-tRNA synthetase (EC 6.1.1.17) (Glutamate--tRNA| ligase) (GluRS) Length = 493 Score = 28.5 bits (62), Expect = 9.9 Identities = 19/42 (45%), Positives = 25/42 (59%), Gaps = 4/42 (9%) Frame = -1 Query: 479 AWEDSERSFK---DVLRDLGVV-DEGLHSGGAGEPLRFNKRE 366 A DSE S+ D LR LG+ DEG+ GG EP R ++R+ Sbjct: 47 AARDSEESYSAIIDSLRWLGMDWDEGVEKGGPHEPYRQSQRK 88
>AROA2_BURPS (P39915) 3-phosphoshikimate 1-carboxyvinyltransferase (EC 2.5.1.19)| (5-enolpyruvylshikimate-3-phosphate synthase) (EPSP synthase) (EPSPS) Length = 463 Score = 28.5 bits (62), Expect = 9.9 Identities = 13/23 (56%), Positives = 15/23 (65%) Frame = -1 Query: 470 DSERSFKDVLRDLGVVDEGLHSG 402 D R+ + LRDLGVV EG H G Sbjct: 52 DDARAMLNALRDLGVVIEGPHQG 74 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,359,995 Number of Sequences: 219361 Number of extensions: 1185294 Number of successful extensions: 3321 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 3271 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3321 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3362826254 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)