| Clone Name | rbaal5a12 |
|---|---|
| Clone Library Name | barley_pub |
>IF2_BIFLO (Q8G3Y5) Translation initiation factor IF-2| Length = 954 Score = 33.5 bits (75), Expect = 0.60 Identities = 23/58 (39%), Positives = 27/58 (46%) Frame = +2 Query: 347 PGHIRPCHPHPHPDSQPLH*GPASGKQARTEQHQGPGKRRLRRGRSLQWGTGYPCHGE 520 PG I P PHP ++P G+ R Q QG G R R GR Q G G P G+ Sbjct: 205 PGDI----PRPHPMARPTADNGRGGRPGRPGQGQGQG-RGFRGGRPGQGGQGGPRPGQ 257
>RERE_HUMAN (Q9P2R6) Arginine-glutamic acid dipeptide repeats protein| (Atrophin-1-like protein) (Atrophin-1-related protein) Length = 1566 Score = 32.7 bits (73), Expect = 1.0 Identities = 23/58 (39%), Positives = 27/58 (46%), Gaps = 5/58 (8%) Frame = +2 Query: 332 HQQHKPGHIRPCHPHPHPDSQPLH*G---PASGKQARTEQH-QG-PGKRRLRRGRSLQ 490 H Q P P HP PHP QPL P++ A+ H QG PG L+ G LQ Sbjct: 807 HPQRPPSPHPPPHPSPHPPLQPLTGSAGQPSAPSHAQPPLHGQGPPGPHSLQAGPLLQ 864
>SOX1_MOUSE (P53783) SOX-1 protein| Length = 391 Score = 32.3 bits (72), Expect = 1.3 Identities = 13/26 (50%), Positives = 15/26 (57%), Gaps = 1/26 (3%) Frame = +2 Query: 329 RHQQHKPGHIRPCHPHPHP-DSQPLH 403 RH P H P HPH HP + QP+H Sbjct: 222 RHPHAHPAHPHPHHPHAHPHNPQPMH 247
>BTBDC_HUMAN (Q8IY92) BTB/POZ domain-containing protein 12| Length = 1151 Score = 32.3 bits (72), Expect = 1.3 Identities = 19/44 (43%), Positives = 22/44 (50%), Gaps = 6/44 (13%) Frame = +2 Query: 344 KPGHIRPCHPHP--HPDSQPLH*GPASGKQA----RTEQHQGPG 457 + GH P PHP HP S PL P SG +A R +H PG Sbjct: 654 RQGHRSPSRPHPGGHPHSSPLAPHPISGDRAHFSRRFLKHSPPG 697
>NO75_MEDSA (P11728) Early nodulin 75 (N-75) (NGM-75) (Fragment)| Length = 97 Score = 32.0 bits (71), Expect = 1.7 Identities = 16/52 (30%), Positives = 28/52 (53%), Gaps = 3/52 (5%) Frame = +2 Query: 317 PLCHRHQQHKPGHIRPCHPHPHPDSQPLH*GPASGK---QARTEQHQGPGKR 463 PL H +++P H +P H HP P+ QP + P K + +++Q P ++ Sbjct: 13 PLEHPPPEYQPPHEKPPHVHPPPEYQPPYQKPPHEKSPYEPPPQEYQPPHEK 64 Score = 30.0 bits (66), Expect = 6.6 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 338 QHKPGHIRPCHPHPHPDSQPLH*GP 412 +++P H +P H HP P+ QP H P Sbjct: 73 EYQPPHEKPPHEHPPPEYQPPHEKP 97
>PHLA1_MOUSE (Q62392) Pleckstrin homology-like domain family A member 1 (T-cell| death-associated gene 51 protein) (Proline- and glutamine-rich protein) (PQR protein) Length = 261 Score = 32.0 bits (71), Expect = 1.7 Identities = 20/56 (35%), Positives = 21/56 (37%) Frame = +2 Query: 317 PLCHRHQQHKPGHIRPCHPHPHPDSQPLH*GPASGKQARTEQHQGPGKRRLRRGRS 484 P H HQ P HPHPHP P P + A H P RL R S Sbjct: 212 PYSHPHQHPHP------HPHPHPHPHP---HPYQLQHAHQPLHSQPQGHRLLRSTS 258
>SLOU_DROME (P22807) Homeobox protein slou (S59/2) (Protein slouch) (Homeobox| protein NK-1) Length = 659 Score = 31.6 bits (70), Expect = 2.3 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 326 HRHQQHKPGHIRPCHPHPHPDSQP 397 H+H H H P HPHPHP P Sbjct: 210 HQHPAHPHSHQHP-HPHPHPHPHP 232 Score = 29.6 bits (65), Expect = 8.7 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +2 Query: 326 HRHQQHKPGHIRPCHPHPHPDSQP 397 H+H QH HPHPHP P Sbjct: 207 HQHHQHPAHPHSHQHPHPHPHPHP 230
>BTBD2_HUMAN (Q9BX70) BTB/POZ domain-containing protein 2| Length = 525 Score = 31.6 bits (70), Expect = 2.3 Identities = 20/60 (33%), Positives = 27/60 (45%) Frame = +2 Query: 347 PGHIRPCHPHPHPDSQPLH*GPASGKQARTEQHQGPGKRRLRRGRSLQWGTGYPCHGERY 526 PG P P P D+Q A+G + R E+ GPG L+R + W P ER+ Sbjct: 55 PGPTPPAPPGPGTDAQ------AAGAE-RAEEAAGPGAAALQREAAYNWQASKPTVQERF 107
>SEPP1_BOVIN (P49907) Selenoprotein P-like protein precursor| Length = 402 Score = 31.6 bits (70), Expect = 2.3 Identities = 19/51 (37%), Positives = 20/51 (39%) Frame = +2 Query: 293 FLAGN*LTPLCHRHQQHKPGHIRPCHPHPHPDSQPLH*GPASGKQARTEQH 445 FLA T + H H P HPHPHP P H P G Q H Sbjct: 190 FLATKEKTAEASQRHHHPHPHSHP-HPHPHPHPHP-HPHPHHGHQLHENAH 238
>ODD_DROME (P23803) Protein odd-skipped| Length = 392 Score = 31.2 bits (69), Expect = 3.0 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +2 Query: 326 HRHQQHKPGHIRPCHPHPHP 385 H H H GH P HPHPHP Sbjct: 150 HPHHHHHHGH--PHHPHPHP 167
>CYAA_NEUCR (Q01631) Adenylate cyclase (EC 4.6.1.1) (ATP pyrophosphate-lyase)| (Adenylyl cyclase) Length = 2300 Score = 31.2 bits (69), Expect = 3.0 Identities = 24/77 (31%), Positives = 32/77 (41%), Gaps = 10/77 (12%) Frame = +2 Query: 392 QPLH*GPAS-GKQARTEQHQGPGKRRLRRGRSLQWGTGYPCHGERYWC---------DGG 541 QP H GP S GK+ R+ + PG R R R+ T + H + D Sbjct: 350 QPSHSGPMSTGKEHRSHSYSLPGSGRSHRDRNYSNATDH--HPSTFGSVSTVGGRDRDAS 407 Query: 542 PP*SLPRAALQKPELTP 592 P S PR + PE+ P Sbjct: 408 PVPSRPRTPVPAPEVVP 424
>SOX1_HUMAN (O00570) SOX-1 protein| Length = 387 Score = 31.2 bits (69), Expect = 3.0 Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = +2 Query: 332 HQQHKPGHIRPCHPHPHP-DSQPLH 403 H P H P HPH HP + QP+H Sbjct: 223 HPHRTPAHPHPHHPHAHPHNPQPMH 247
>BARH1_DROAN (P22544) Homeobox protein B-H1 (Homeobox BarH1 protein)| Length = 606 Score = 31.2 bits (69), Expect = 3.0 Identities = 14/27 (51%), Positives = 14/27 (51%) Frame = +2 Query: 317 PLCHRHQQHKPGHIRPCHPHPHPDSQP 397 PL H H Q P HPHPHP S P Sbjct: 164 PLHHLHPQSHP------HPHPHPHSHP 184
>SYI_SYNEL (Q8DGI7) Isoleucyl-tRNA synthetase (EC 6.1.1.5) (Isoleucine--tRNA| ligase) (IleRS) Length = 953 Score = 30.8 bits (68), Expect = 3.9 Identities = 20/61 (32%), Positives = 28/61 (45%) Frame = +2 Query: 335 QQHKPGHIRPCHPHPHPDSQPLH*GPASGKQARTEQHQGPGKRRLRRGRSLQWGTGYPCH 514 QQ PG + H P + LH G A K + + K +L RGR + + G+ CH Sbjct: 46 QQTNPGEVFILHDGPPYANGALHIGHALNKILKDIIN----KYQLLRGRKVHYRPGWDCH 101 Query: 515 G 517 G Sbjct: 102 G 102
>PO3F3_HUMAN (P20264) POU domain, class 3, transcription factor 3| (Brain-specific homeobox/POU domain protein 1) (Brain-1) (Brn-1 protein) Length = 500 Score = 30.8 bits (68), Expect = 3.9 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +2 Query: 314 TPLCHRHQQHKPGHIRPCHPHPHPDSQPLH*GPASG 421 TP H H H P PHPH P H G G Sbjct: 264 TPELAEHHHHHHHHAHPHPPHPHHAQGPPHHGGGGG 299
>NO75_PEA (P16329) Early nodulin 75 protein (N-75) (NGM-75) (Fragment)| Length = 112 Score = 30.4 bits (67), Expect = 5.1 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = +2 Query: 338 QHKPGHIRPCHPHPHPDSQPLH*GPASGK 424 +++P H +P H HP P+ QP H P K Sbjct: 14 EYQPPHEKPPHEHPPPEYQPPHEKPPHEK 42
>RERE_MOUSE (Q80TZ9) Arginine-glutamic acid dipeptide repeats protein| (Atrophin-2) Length = 1558 Score = 30.4 bits (67), Expect = 5.1 Identities = 23/68 (33%), Positives = 28/68 (41%), Gaps = 8/68 (11%) Frame = +2 Query: 311 LTPLCHRHQQHKPGHIRPCHPHPHPDSQPLH*GPASGKQARTEQH-------QG-PGKRR 466 + P H H Q P P P PHP QP+ A Q+ + H QG PG Sbjct: 792 VAPAAHTHIQQAPTLHPPRLPSPHPPLQPM---TAPPSQSSAQPHPQPSLHGQGPPGPHS 848 Query: 467 LRRGRSLQ 490 L+ G LQ Sbjct: 849 LQTGPLLQ 856
>ACH3_DROME (P04755) Acetylcholine receptor protein, beta-like subunit 1| precursor Length = 521 Score = 29.6 bits (65), Expect = 8.7 Identities = 15/40 (37%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +2 Query: 329 RHQQHKPGHIRPCHPHP---HPDSQPLH*GPASGKQARTE 439 R PG P HPHP P P H GKQ++ E Sbjct: 360 RWMMEMPGMSMPAHPHPSYGSPAELPKHISAIGGKQSKME 399
>FOXGA_HUMAN (P55316) Forkhead box protein G1A (Forkhead-related protein FKHL2)| (Transcription factor BF-2) (Brain factor 2) (BF2) (HFK2) Length = 469 Score = 29.6 bits (65), Expect = 8.7 Identities = 15/46 (32%), Positives = 18/46 (39%) Frame = +2 Query: 317 PLCHRHQQHKPGHIRPCHPHPHPDSQPLH*GPASGKQARTEQHQGP 454 P H H H H P P P P Q P + AR + +GP Sbjct: 45 PQHHHHHHHHHHHPPPPAPQPPPPPQQQQPPPPPRRGARRRRRRGP 90 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,635,668 Number of Sequences: 219361 Number of extensions: 1953797 Number of successful extensions: 5331 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 4880 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5245 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6541540170 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)