| Clone Name | rbaal4j13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DCDA_METJA (Q58497) Diaminopimelate decarboxylase (EC 4.1.1.20) ... | 30 | 4.9 | 2 | ASNS_MOUSE (Q61024) Asparagine synthetase [glutamine-hydrolyzing... | 30 | 8.4 |
|---|
>DCDA_METJA (Q58497) Diaminopimelate decarboxylase (EC 4.1.1.20) (DAP| decarboxylase) Length = 438 Score = 30.4 bits (67), Expect = 4.9 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +1 Query: 520 PGQQLPDTADLLMFQGSHYKQTPLSKWELL 609 PG+ L TA L+ + H K+TP++KW ++ Sbjct: 295 PGRSLVATAGYLLGKVHHIKETPVTKWVMI 324
>ASNS_MOUSE (Q61024) Asparagine synthetase [glutamine-hydrolyzing] (EC 6.3.5.4)| (Glutamine-dependent asparagine synthetase) Length = 560 Score = 29.6 bits (65), Expect = 8.4 Identities = 15/66 (22%), Positives = 33/66 (50%) Frame = -3 Query: 598 IWKAASVYSGFLGTSANLRYQVIAGLVEHRLGEYLVSYYNQPFLSNVLSFVARIINSYFG 419 +W+ +S + + N ++++ VEH++ + ++S +Q F N + YF Sbjct: 462 LWRPKEAFSDGITSVKNSWFKILQDYVEHQVDDEMMSAASQKFPFN----TPKTKEGYFY 517 Query: 418 TQLFQR 401 Q+F+R Sbjct: 518 RQIFER 523 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 85,123,035 Number of Sequences: 219361 Number of extensions: 1617491 Number of successful extensions: 3147 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3093 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3147 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6370891296 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)