| Clone Name | rbaal4h19 |
|---|---|
| Clone Library Name | barley_pub |
>NPLP3_DROME (Q9VV28) Neuropeptide-like 3 precursor [Contains: SHA-peptide;| VVI-amide peptide] Length = 90 Score = 31.2 bits (69), Expect = 2.4 Identities = 14/39 (35%), Positives = 21/39 (53%) Frame = -3 Query: 352 SPTRSPAACGPGRLAPSSWGENLVSRKSSILTPSFMQIV 236 +P +P GPG +AP WG +V S +L P + +V Sbjct: 23 APAPAPGLIGPGIVAPGIWGPTVVG--SPLLAPQVVSVV 59
>AGI_URTDI (P11218) Lectin/endochitinase precursor (EC 3.2.1.14) (Agglutinin)| (UDA) Length = 372 Score = 30.4 bits (67), Expect = 4.0 Identities = 13/30 (43%), Positives = 13/30 (43%), Gaps = 3/30 (10%) Frame = -3 Query: 403 WTWCGRCSP---GGCRCACWSPTRSPAACG 323 W WCG P C CWS RS CG Sbjct: 44 WGWCGDSEPYCGRTCENKCWSGERSDHRCG 73
>MUTS_DEHE1 (Q3Z767) DNA mismatch repair protein mutS| Length = 858 Score = 30.0 bits (66), Expect = 5.3 Identities = 19/49 (38%), Positives = 26/49 (53%) Frame = +3 Query: 204 MRCIHGRIRQKTICMNEGVRMEDFLETRFSPHDEGANLPGPHAAGDLVG 350 M I RIRQKTI E + +++ LET + H + +P P A L G Sbjct: 345 MERIANRIRQKTILPKELISLKNSLETVSAIHRQFGLMPPPRLAYFLNG 393
>GBF1_CRIGR (Q9R1D7) Golgi-specific brefeldin A-resistance guanine nucleotide| exchange factor 1 (BFA-resistant GEF 1) Length = 1856 Score = 29.6 bits (65), Expect = 6.9 Identities = 17/47 (36%), Positives = 21/47 (44%) Frame = -3 Query: 394 CGRCSPGGCRCACWSPTRSPAACGPGRLAPSSWGENLVSRKSSILTP 254 C P G R S SP A P RL+PS G +++ IL P Sbjct: 1763 CDSEKPEGTRATSSSSPGSPVASSPSRLSPSPEGPPPLAQPPLILQP 1809
>ANK2_HUMAN (Q01484) Ankyrin-2 (Brain ankyrin) (Ankyrin-B) (Ankyrin,| nonerythroid) Length = 3924 Score = 29.6 bits (65), Expect = 6.9 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 1/53 (1%) Frame = +1 Query: 274 SWKRDFHPTTKGPISPARMPRAISLATSRHTDTH-PASTAHTMSSMYAASPRG 429 S + + HP P+SP R + + ++ S TD H P STA SP G Sbjct: 1886 SGRTEKHP----PVSPGRTEKRLPVSPSGRTDKHQPVSTAGKTEKHLPVSPSG 1934
>KRA53_HUMAN (Q6L8H2) Keratin-associated protein 5-3 (Keratin-associated protein| 5.3) (Ultrahigh sulfur keratin-associated protein 5.3) (Keratin-associated protein 5-9) (Keratin-associated protein 5.9) (UHS KerB-like) Length = 238 Score = 26.9 bits (58), Expect(2) = 7.3 Identities = 12/30 (40%), Positives = 15/30 (50%), Gaps = 2/30 (6%) Frame = -3 Query: 406 CWTWCGRC--SPGGCRCACWSPTRSPAACG 323 C CG C S GGC +C P ++CG Sbjct: 73 CKGGCGSCGGSKGGCGSSCCVPVCCSSSCG 102 Score = 21.2 bits (43), Expect(2) = 7.3 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = -1 Query: 540 GRSGSSPTPSCRLGVCGIACLLCNSSGSGVREG 442 G SG S G CG +C C S G G Sbjct: 2 GCSGCSGGCGSSCGGCGSSCGGCGSGYGGCGSG 34
>HUNB_MUSDO (Q01778) Protein hunchback| Length = 817 Score = 29.3 bits (64), Expect = 9.0 Identities = 22/80 (27%), Positives = 30/80 (37%), Gaps = 11/80 (13%) Frame = +1 Query: 295 PTTKGPISPARMPRAI-----------SLATSRHTDTHPASTAHTMSSMYAASPRGIVIL 441 PTT PI P+++ S+ T H H +TA+T +S A+S Sbjct: 682 PTTSSPIHPSQVNGVAAGAADHSSADESMETGHHHHHHNPTTANTSASSTASSSGNSSNS 741 Query: 442 SFPYPXXXXXXXXXGNSTNT 501 S GNS NT Sbjct: 742 SSTSTSSNSNSSSAGNSPNT 761
>DPO3A_BUCAP (Q8K9S3) DNA polymerase III alpha subunit (EC 2.7.7.7)| Length = 1161 Score = 29.3 bits (64), Expect = 9.0 Identities = 24/88 (27%), Positives = 44/88 (50%), Gaps = 6/88 (6%) Frame = +3 Query: 54 NCLHDYQKYRTEGLYKER-REQKHHLESVTSVNGEAIQLNTNGDLGTLYSTMRCIHG--- 221 +CLH Y+KY + Y E R + + E S+ A+ L+ + ++ + + C Sbjct: 154 DCLHFYEKYFSGFYYLELIRTYRENEEKYLSL---AVDLSYSQNIPVVATNDVCFLNKED 210 Query: 222 -RIRQKTICMNEGVRM-EDFLETRFSPH 299 +I + I +NEGVR+ E ++ +S H Sbjct: 211 FKIHKIRIAINEGVRLKESKIQNNYSKH 238 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 86,391,792 Number of Sequences: 219361 Number of extensions: 1757682 Number of successful extensions: 5832 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 5570 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5822 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5216272880 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)