| Clone Name | rbaal4g04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | COBS_THETN (Q8RCN8) Cobalamin synthase (EC 2.-.-.-) | 28 | 4.7 | 2 | KI59C_DROME (Q9W1U4) Kinesin-like protein Klp59C (Kinesin-like p... | 28 | 8.1 |
|---|
>COBS_THETN (Q8RCN8) Cobalamin synthase (EC 2.-.-.-)| Length = 248 Score = 28.5 bits (62), Expect = 4.7 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = -1 Query: 218 LPAKEDRLGMMSAHAPFQGLLIGLILNLAFCXAKAVTS 105 + KED++ ++++ P GLLIG IL +A+ K + S Sbjct: 23 IDVKEDKIYKIASYFPVVGLLIGGILYIAYLLLKDLFS 60
>KI59C_DROME (Q9W1U4) Kinesin-like protein Klp59C (Kinesin-like protein at| cytological position 59C) Length = 626 Score = 27.7 bits (60), Expect = 8.1 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = -1 Query: 197 LGMMSAHAPFQGLLIGLILNLAFCXAKAVTSLLLFGVTP 81 LG S+H PF+G + +L +F K V + ++ ++P Sbjct: 462 LGRQSSHLPFRGSKLTQVLRDSFIGGKKVKTCMIAMISP 500 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 30,175,115 Number of Sequences: 219361 Number of extensions: 437759 Number of successful extensions: 1147 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1137 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1147 length of database: 80,573,946 effective HSP length: 62 effective length of database: 66,973,564 effective search space used: 1607365536 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)