| Clone Name | rbaal4g01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NQRD_NEIMB (Q9K0M6) Na(+)-translocating NADH-quinone reductase s... | 31 | 2.8 | 2 | NQRD_NEIMA (Q9JVQ1) Na(+)-translocating NADH-quinone reductase s... | 31 | 2.8 | 3 | CASR_HUMAN (P41180) Extracellular calcium-sensing receptor precu... | 30 | 6.3 |
|---|
>NQRD_NEIMB (Q9K0M6) Na(+)-translocating NADH-quinone reductase subunit D (EC| 1.6.5.-) (Na(+)-translocating NQR subunit D) (Na(+)-NQR subunit D) (NQR complex subunit D) (NQR-1 subunit D) Length = 208 Score = 31.2 bits (69), Expect = 2.8 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 4/41 (9%) Frame = -1 Query: 164 LGLVLQICNLLGHLYQGFVY----QLTIFLGLVCTRVILMG 54 + ++ + L+ L Q F Y QL++F+GL+ T I+MG Sbjct: 76 MAIIASLVTLVDQLLQAFAYELSKQLSVFVGLIITNCIVMG 116
>NQRD_NEIMA (Q9JVQ1) Na(+)-translocating NADH-quinone reductase subunit D (EC| 1.6.5.-) (Na(+)-translocating NQR subunit D) (Na(+)-NQR subunit D) (NQR complex subunit D) (NQR-1 subunit D) Length = 208 Score = 31.2 bits (69), Expect = 2.8 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 4/41 (9%) Frame = -1 Query: 164 LGLVLQICNLLGHLYQGFVY----QLTIFLGLVCTRVILMG 54 + ++ + L+ L Q F Y QL++F+GL+ T I+MG Sbjct: 76 MAIIASLVTLVDQLLQAFAYELSKQLSVFVGLIITNCIVMG 116
>CASR_HUMAN (P41180) Extracellular calcium-sensing receptor precursor (CaSR)| (Parathyroid Cell calcium-sensing receptor) Length = 1078 Score = 30.0 bits (66), Expect = 6.3 Identities = 16/61 (26%), Positives = 29/61 (47%) Frame = -1 Query: 221 PNCFRHQ*VETFLMYSTCHLGLVLQICNLLGHLYQGFVYQLTIFLGLVCTRVILMGIKIP 42 P+ +R+Q +E +++ TCH G ++ + GF+ T L +C K+P Sbjct: 748 PSSYRNQELEDEIIFITCHEGSLMAL---------GFLIGYTCLLAAICFFFAFKSRKLP 798 Query: 41 E 39 E Sbjct: 799 E 799 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 104,536,254 Number of Sequences: 219361 Number of extensions: 2337988 Number of successful extensions: 4920 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4768 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4919 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6257125380 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)