| Clone Name | rbaal4f16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PTAFR_BOVIN (Q9TTY5) Platelet-activating factor receptor (PAF-R)... | 30 | 4.4 | 2 | PTAFR_MOUSE (Q62035) Platelet-activating factor receptor (PAF-R) | 29 | 9.8 |
|---|
>PTAFR_BOVIN (Q9TTY5) Platelet-activating factor receptor (PAF-R) (PAFr)| Length = 342 Score = 30.4 bits (67), Expect = 4.4 Identities = 17/48 (35%), Positives = 27/48 (56%) Frame = +3 Query: 447 AVQQMPLTSEATDRNRGMYSTLLVWITIFMTESGAAYMPVPKRTQRMP 590 AV + T++AT R RG+ +L++W++I A+Y V T R P Sbjct: 118 AVTRPIKTAQATTRKRGILLSLIIWVSIV---GAASYFFVLDSTNREP 162
>PTAFR_MOUSE (Q62035) Platelet-activating factor receptor (PAF-R)| Length = 341 Score = 29.3 bits (64), Expect = 9.8 Identities = 11/26 (42%), Positives = 19/26 (73%) Frame = +3 Query: 468 TSEATDRNRGMYSTLLVWITIFMTES 545 T++AT R RG+ +L++W++I T S Sbjct: 125 TAQATTRKRGISLSLIIWVSIVATAS 150 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 75,693,465 Number of Sequences: 219361 Number of extensions: 1346012 Number of successful extensions: 3564 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3481 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3563 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5653129581 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)