| Clone Name | rbaal4f12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LEPA_BUCAP (Q8K9Q9) GTP-binding protein lepA | 31 | 4.7 | 2 | TRUB_CARHZ (Q3ABA1) tRNA pseudouridine synthase B (EC 5.4.99.-) ... | 30 | 8.0 |
|---|
>LEPA_BUCAP (Q8K9Q9) GTP-binding protein lepA| Length = 601 Score = 30.8 bits (68), Expect = 4.7 Identities = 17/57 (29%), Positives = 27/57 (47%), Gaps = 3/57 (5%) Frame = -1 Query: 497 LVDGCFDLIERRSRFDVLSRIKMEGEHGALVFN---LIIFRDSVEATIHMNFLEVPG 336 L+ C L ER VL + +E E G + +I ++D H+NF++ PG Sbjct: 28 LIQKCGGLSEREMSDQVLDSMDLEKERGITIKAQSVMIDYKDKNGNVFHLNFIDTPG 84
>TRUB_CARHZ (Q3ABA1) tRNA pseudouridine synthase B (EC 5.4.99.-) (tRNA| pseudouridine 55 synthase) (Psi55 synthase) (tRNA-uridine isomerase) (tRNA pseudouridylate synthase) Length = 288 Score = 30.0 bits (66), Expect = 8.0 Identities = 20/73 (27%), Positives = 33/73 (45%) Frame = -1 Query: 617 SASDYLRLLSPKRGISMKFDCLVEVDIRTKASPGDTDDKNLVDGCFDLIERRSRFDVLSR 438 S Y+R ++ + G +K ++ +RT++ P DD NL+ F LI F + Sbjct: 171 SRGTYIRSIANEIGNLLKTGATLKFLLRTRSGPFLLDDSNLLHEDFTLIPPEQLFQDFPK 230 Query: 437 IKMEGEHGALVFN 399 I + E V N Sbjct: 231 INLTREQYLRVKN 243 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 111,957,760 Number of Sequences: 219361 Number of extensions: 2411936 Number of successful extensions: 6200 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5933 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6200 length of database: 80,573,946 effective HSP length: 110 effective length of database: 56,444,236 effective search space used: 7902193040 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)