| Clone Name | rbaal3p07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | VGLX_EHV1B (P28968) Glycoprotein X precursor | 30 | 2.1 | 2 | VGLX_EHV1V (Q6S6W0) Glycoprotein X precursor | 30 | 2.1 |
|---|
>VGLX_EHV1B (P28968) Glycoprotein X precursor| Length = 797 Score = 29.6 bits (65), Expect = 2.1 Identities = 21/64 (32%), Positives = 26/64 (40%), Gaps = 6/64 (9%) Frame = +3 Query: 6 DNGAITEHTSTYIHTTPRAE-----HRRRASKITTPXXXXXXXXPLPDSIRXS-DARYSR 167 DNG T+HT+ HTT A+ HR RA P PD + S D Y Sbjct: 474 DNGVSTQHTTINDHTTANAQKHAGHHRGRAGGRRGSPQGGSHTTPHPDRLTPSPDDTYDD 533 Query: 168 XLSH 179 +H Sbjct: 534 DTNH 537
>VGLX_EHV1V (Q6S6W0) Glycoprotein X precursor| Length = 866 Score = 29.6 bits (65), Expect = 2.1 Identities = 21/64 (32%), Positives = 26/64 (40%), Gaps = 6/64 (9%) Frame = +3 Query: 6 DNGAITEHTSTYIHTTPRAE-----HRRRASKITTPXXXXXXXXPLPDSIRXS-DARYSR 167 DNG T+HT+ HTT A+ HR RA P PD + S D Y Sbjct: 543 DNGVSTQHTTINDHTTANAQKHAGHHRGRAGGRRGSPQGGSHTTPHPDRLTPSPDDTYDD 602 Query: 168 XLSH 179 +H Sbjct: 603 DTNH 606 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 24,997,971 Number of Sequences: 219361 Number of extensions: 279387 Number of successful extensions: 842 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 821 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 838 length of database: 80,573,946 effective HSP length: 71 effective length of database: 64,999,315 effective search space used: 1559983560 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)