| Clone Name | rbaal3o22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CC14A_MOUSE (Q6GQT0) Dual specificity protein phosphatase CDC14A... | 33 | 0.46 | 2 | IE0_NPVLD (O36453) Immediate-early protein IE-0 (Immediate early... | 32 | 1.3 | 3 | TEP1_HUMAN (Q99973) Telomerase protein component 1 (Telomerase-a... | 29 | 8.6 | 4 | RUNX2_MOUSE (Q08775) Runt-related transcription factor 2 (Core-b... | 29 | 8.6 |
|---|
>CC14A_MOUSE (Q6GQT0) Dual specificity protein phosphatase CDC14A (EC 3.1.3.48)| (EC 3.1.3.16) (CDC14 cell division cycle 14 homolog A) Length = 603 Score = 33.5 bits (75), Expect = 0.46 Identities = 32/121 (26%), Positives = 51/121 (42%), Gaps = 4/121 (3%) Frame = -1 Query: 539 PDPHVPEEYSVSLAEPWMSQNSTVQYIPSASQGGLSYIPGQVQDSHI---LNSAQQGHFP 369 P H +E SL S ++ PS S+G ++ I + D I L+ Q Sbjct: 319 PQQHFLKEKQASLWVQGDIFRSKLKNRPS-SEGSITKIISTLDDMSIGANLSKLQSTERI 377 Query: 368 PRNPFDE*GLLVKNGADDGQMRRLIRTARNPK-GPSGVLYA*DQKHHSRYLRFHCLTPSS 192 N F++ + +KN G R +++ R+P+ PS + D K H R + SS Sbjct: 378 GENNFEDEDMEIKNNVTQGDKLRALKSQRHPRSSPSCAFRSDDMKGHQRAMAQTFRLSSS 437 Query: 191 P 189 P Sbjct: 438 P 438
>IE0_NPVLD (O36453) Immediate-early protein IE-0 (Immediate early 0 protein)| (Immediate early transactivator 0) Length = 258 Score = 32.0 bits (71), Expect = 1.3 Identities = 11/34 (32%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = -2 Query: 142 ESFHLKQSCCVLQLC--CILRVWRFCSAQFVICP 47 E F CC ++C C ++W FC+ + +CP Sbjct: 201 EQFLKPNVCCGYRVCNACYAKLWEFCTGAYPVCP 234
>TEP1_HUMAN (Q99973) Telomerase protein component 1 (Telomerase-associated| protein 1) (Telomerase protein 1) (p240) (p80 telomerase homolog) Length = 2627 Score = 29.3 bits (64), Expect = 8.6 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = -1 Query: 518 EYSVSLAEPWMSQNSTVQYIPSASQGGLSYI 426 E SVS EPW+ NST+Q QG + ++ Sbjct: 2594 EGSVSCLEPWLGANSTLQLAVGDVQGNVYFL 2624
>RUNX2_MOUSE (Q08775) Runt-related transcription factor 2 (Core-binding factor,| alpha 1 subunit) (CBF-alpha 1) (Acute myeloid leukemia 3 protein) (Oncogene AML-3) (Polyomavirus enhancer-binding protein 2 alpha A subunit) (PEBP2-alpha A) (PEA2-alpha A) (SL Length = 607 Score = 29.3 bits (64), Expect = 8.6 Identities = 20/66 (30%), Positives = 30/66 (45%), Gaps = 3/66 (4%) Frame = +3 Query: 153 AIYNSAHSFLIYRRAGSETMESKISTVVFLISSI*Y---TRWSFWIPSGSNQPPHLSIIS 323 +IYN H F + ++ G+ S S V S + T F PS S QP +S +S Sbjct: 63 SIYNRGHKFYLEKKGGTMASNSLFSAVTPCQQSFFWDPSTSRRFSPPSSSLQPGKMSDVS 122 Query: 324 TILYQQ 341 ++ Q Sbjct: 123 PVVAAQ 128 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 89,991,015 Number of Sequences: 219361 Number of extensions: 1996022 Number of successful extensions: 4963 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4832 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4963 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4986986160 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)