| Clone Name | rbaal3o01 |
|---|---|
| Clone Library Name | barley_pub |
>RL13_ARATH (P41127) 60S ribosomal protein L13 (BBC1 protein homolog)| Length = 206 Score = 40.0 bits (92), Expect = 0.007 Identities = 19/28 (67%), Positives = 21/28 (75%) Frame = -3 Query: 378 GIPKKLVMTIRIFLDHRRKNMSLQGQDT 295 GIPKKL TI I +DHRRKN SL+G T Sbjct: 83 GIPKKLAPTIGIAVDHRRKNRSLEGLQT 110
>RL132_BRANA (P41129) 60S ribosomal protein L13-2 (Cold-induced protein C24B)| Length = 206 Score = 40.0 bits (92), Expect = 0.007 Identities = 19/25 (76%), Positives = 20/25 (80%) Frame = -3 Query: 378 GIPKKLVMTIRIFLDHRRKNMSLQG 304 GIPKKL TI I LDHRRKN SL+G Sbjct: 83 GIPKKLAPTIGISLDHRRKNRSLEG 107
>RL131_BRANA (P41128) 60S ribosomal protein L13-1 (Cold-induced protein C24A)| Length = 206 Score = 38.9 bits (89), Expect = 0.016 Identities = 18/25 (72%), Positives = 20/25 (80%) Frame = -3 Query: 378 GIPKKLVMTIRIFLDHRRKNMSLQG 304 GIPKKL TI I +DHRRKN SL+G Sbjct: 83 GIPKKLAPTIGIAVDHRRKNRSLEG 107
>RL13_TOBAC (P49627) 60S ribosomal protein L13 (Clone 6.2.1)| Length = 202 Score = 38.9 bits (89), Expect = 0.016 Identities = 18/28 (64%), Positives = 21/28 (75%) Frame = -3 Query: 378 GIPKKLVMTIRIFLDHRRKNMSLQGQDT 295 GIPKKL TI I +DHRR+N SL+G T Sbjct: 79 GIPKKLAPTIGIAVDHRRRNRSLEGLQT 106
>MODC_METCA (Q608V9) Molybdenum import ATP-binding protein modC (EC 3.6.3.29)| Length = 356 Score = 35.0 bits (79), Expect = 0.23 Identities = 20/54 (37%), Positives = 25/54 (46%) Frame = +2 Query: 134 PFSHRQPSSSGLPTCVGSTSPHEAYLIHVHLAAMSDGHVIALDPLRRCRFYLDL 295 P+ R +P S SP E + HL AM +G VIA PL+ LDL Sbjct: 172 PYLERLHDELDIPVLYVSHSPDEVARLADHLVAMEEGRVIAAGPLKETLARLDL 225
>RL13_CHLSW (O48513) 60S ribosomal protein L13 (BBC1 protein homolog)| Length = 208 Score = 32.3 bits (72), Expect = 1.5 Identities = 14/24 (58%), Positives = 17/24 (70%) Frame = -3 Query: 378 GIPKKLVMTIRIFLDHRRKNMSLQ 307 GIP K T+ I +DHRRKN SL+ Sbjct: 84 GIPAKFAPTVGIAVDHRRKNRSLE 107
>RL13_SCHMA (Q95043) 60S ribosomal protein L13 (BBC1 protein homolog)| Length = 184 Score = 29.6 bits (65), Expect = 9.6 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = -3 Query: 378 GIPKKLVMTIRIFLDHRRKNMSLQG 304 G+ K TI I +DHRR+N+S++G Sbjct: 84 GLNPKFARTIGIAVDHRRRNVSVEG 108 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 107,739,120 Number of Sequences: 219361 Number of extensions: 2359309 Number of successful extensions: 4829 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 4665 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4827 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7252940416 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)