| Clone Name | rbaal3n10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HTPG_BACHD (Q9KE51) Chaperone protein htpG (Heat shock protein h... | 28 | 6.1 | 2 | SALL3_MOUSE (Q62255) Sal-like protein 3 (Spalt-like protein 3) (... | 28 | 8.0 |
|---|
>HTPG_BACHD (Q9KE51) Chaperone protein htpG (Heat shock protein htpG) (High| temperature protein G) Length = 625 Score = 28.1 bits (61), Expect = 6.1 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = -3 Query: 245 NSTAALRNGNPSDEQHDVILEVAWVLYSAGLIAPMFTVTCK 123 + + A + N S + HD+I + YSA ++A TVT K Sbjct: 97 SGSLAFKTENESKDGHDIIGQFGVGFYSAFMVADKVTVTTK 137
>SALL3_MOUSE (Q62255) Sal-like protein 3 (Spalt-like protein 3) (MSal)| (Fragment) Length = 1323 Score = 27.7 bits (60), Expect = 8.0 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = +1 Query: 100 QLPVTKPTLHVTVNMGAISPAEYSTQATSKITSCCSSL 213 QLP T P H + +I+P S Q S +S C+SL Sbjct: 507 QLPPTVPGTHNYTDSPSITPVSRSPQRPSPASSECTSL 544 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 33,844,194 Number of Sequences: 219361 Number of extensions: 566553 Number of successful extensions: 1368 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1340 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1368 length of database: 80,573,946 effective HSP length: 65 effective length of database: 66,315,481 effective search space used: 1591571544 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)