| Clone Name | rbaal3n04 |
|---|---|
| Clone Library Name | barley_pub |
>ACINU_MOUSE (Q9JIX8) Apoptotic chromatin condensation inducer in the nucleus| (Acinus) Length = 1338 Score = 46.6 bits (109), Expect = 4e-05 Identities = 23/53 (43%), Positives = 36/53 (67%), Gaps = 2/53 (3%) Frame = -1 Query: 271 AREKLPPTPKKA--EPPVVTLDDLFRKTQSSPRIYYLPLSDEEVSARLAAQGK 119 ++EK +KA EPP LDDLFRKT+++P IY+LPL++ ++ + A Q + Sbjct: 1190 SKEKKSEKKEKAQEEPPAKLLDDLFRKTKAAPCIYWLPLTESQIVQKEAEQAE 1242
>ACINU_HUMAN (Q9UKV3) Apoptotic chromatin condensation inducer in the nucleus| (Acinus) Length = 1341 Score = 46.6 bits (109), Expect = 4e-05 Identities = 23/53 (43%), Positives = 36/53 (67%), Gaps = 2/53 (3%) Frame = -1 Query: 271 AREKLPPTPKKA--EPPVVTLDDLFRKTQSSPRIYYLPLSDEEVSARLAAQGK 119 ++EK +KA EPP LDDLFRKT+++P IY+LPL+D ++ + A + + Sbjct: 1191 SKEKKSEKKEKAQEEPPAKLLDDLFRKTKAAPCIYWLPLTDSQIVQKEAERAE 1243
>YI32_AGRT7 (P05679) Insertion element IS136 hypothetical 21.2 kDa protein| Length = 194 Score = 32.3 bits (72), Expect = 0.72 Identities = 27/81 (33%), Positives = 37/81 (45%), Gaps = 2/81 (2%) Frame = -1 Query: 283 PAGSAREKLPPTPKKAEPPVVTLDDLFRKTQSSPRIYYLPLSDEEVSARLAAQGKAN*CP 104 P S PTP + +PPV +L + + + +PR+ +LP S R A KAN P Sbjct: 70 PPSSCDRACAPTPGR-DPPVSSLPNSRQPARQNPRLQHLPRS------RACATDKANWAP 122 Query: 103 H--ASGTCIFCKDWFYLL*DC 47 ASG + LL DC Sbjct: 123 RMTASGRRYRLAGFKTLLNDC 143
>KRA93_HUMAN (Q9BYQ3) Keratin-associated protein 9-3 (Keratin-associated protein| 9.3) (Ultrahigh sulfur keratin-associated protein 9.3) Length = 159 Score = 31.2 bits (69), Expect = 1.6 Identities = 20/56 (35%), Positives = 24/56 (42%), Gaps = 5/56 (8%) Frame = -3 Query: 368 SKCALPSCCYTK-----GATTASSTPCEASYI*SSRICKGEAPTHPKEGRTSCCDT 216 S C P+CC T TT SSTPC S C + HP + +CC T Sbjct: 6 SPCCQPTCCRTTCWQPTTVTTCSSTPCCQPSCCVSSCC--QPCCHPTCCQNTCCRT 59
>KRA59_HUMAN (P26371) Keratin-associated protein 5-9 (Keratin-associated protein| 5.9) (Ultrahigh sulfur keratin-associated protein 5.9) (Keratin, cuticle, ultrahigh sulfur 1) (Keratin, ultra high-sulfur matrix protein A) (UHS keratin A) (UHS KerA) Length = 169 Score = 30.4 bits (67), Expect = 2.7 Identities = 18/64 (28%), Positives = 25/64 (39%), Gaps = 1/64 (1%) Frame = -3 Query: 404 TKGGSFSARSGESKCALPSCCYTKGATTASSTPCEASYI*SSRICKGEAPTHPKEGR-TS 228 +KGG S + C P CC + ++ C Y CK P GR +S Sbjct: 68 SKGGCGSCGCSQCSCCKPCCCSSGCGSSCCQCSCCKPYCSQCSCCK---PCCSSSGRGSS 124 Query: 227 CCDT 216 CC + Sbjct: 125 CCQS 128
>KRA42_HUMAN (Q9BYR5) Keratin-associated protein 4-2 (Keratin-associated protein| 4.2) (Ultrahigh sulfur keratin-associated protein 4.2) Length = 136 Score = 29.3 bits (64), Expect = 6.1 Identities = 19/57 (33%), Positives = 23/57 (40%), Gaps = 8/57 (14%) Frame = -3 Query: 362 CALPSCCYTKGATTASSTPCEASYI*SS--------RICKGEAPTHPKEGRTSCCDT 216 C PSCC T T +T C S SS +C P G+T+CC T Sbjct: 60 CCSPSCCQT---TCCRTTCCRPSCCVSSCFRPQCCQSVCCQPTCCRPSCGQTTCCRT 113
>SHAN2_HUMAN (Q9UPX8) SH3 and multiple ankyrin repeat domains protein 2 (Shank2)| Length = 1253 Score = 28.9 bits (63), Expect = 7.9 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -1 Query: 286 DPAGSAREKLPPTPKKAEPPVVTL 215 DP +AR+K PP PK+A +TL Sbjct: 135 DPDDTARKKAPPPPKRAPTTALTL 158
>SHAN2_RAT (Q9QX74) SH3 and multiple ankyrin repeat domains protein 2 (Shank2)| (Proline-rich synapse-associated protein 1) (ProSAP1) (Cortactin-binding protein 1) (CortBP1) (GKAP/SAPAP-interacting protein) (SPANK-3) Length = 1474 Score = 28.9 bits (63), Expect = 7.9 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -1 Query: 286 DPAGSAREKLPPTPKKAEPPVVTL 215 DP +AR+K PP PK+A +TL Sbjct: 346 DPDDTARKKAPPPPKRAPTTALTL 369
>KRA45_HUMAN (Q9BYR2) Keratin-associated protein 4-5 (Keratin-associated protein| 4.5) (Ultrahigh sulfur keratin-associated protein 4.5) Length = 186 Score = 28.9 bits (63), Expect = 7.9 Identities = 18/60 (30%), Positives = 21/60 (35%), Gaps = 2/60 (3%) Frame = -3 Query: 395 GSFSARS--GESKCALPSCCYTKGATTASSTPCEASYI*SSRICKGEAPTHPKEGRTSCC 222 GS S+ G C PSCC T T P +C HP +SCC Sbjct: 7 GSVSSEQSCGLENCCCPSCCQTTCCRTTCCRPSCCKPQCCQSVCYQPTCCHPSCCISSCC 66 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,890,748 Number of Sequences: 219361 Number of extensions: 1314471 Number of successful extensions: 4317 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 3979 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4303 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3523384522 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)