| Clone Name | rbaal3k15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MUTS_CHLAB (Q5L554) DNA mismatch repair protein mutS | 32 | 2.4 | 2 | FADJ_PHOPR (Q6LTK3) Fatty acid oxidation complex alpha subunit [... | 30 | 7.1 | 3 | MUTS_CHLPN (Q9Z6W5) DNA mismatch repair protein mutS | 30 | 7.1 |
|---|
>MUTS_CHLAB (Q5L554) DNA mismatch repair protein mutS| Length = 826 Score = 31.6 bits (70), Expect = 2.4 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +3 Query: 597 HINGLDDLEDHLPCMDTFGASSSSRHNRPLFMY 695 H L DLE+H P ++ F AS +P+F+Y Sbjct: 738 HYKELTDLENHCPHVENFHASVKENGGQPVFLY 770
>FADJ_PHOPR (Q6LTK3) Fatty acid oxidation complex alpha subunit [Includes:| Enoyl-CoA hydratase (EC 4.2.1.17); 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35); 3-hydroxybutyryl-CoA epimerase (EC 5.1.2.3)] Length = 715 Score = 30.0 bits (66), Expect = 7.1 Identities = 29/101 (28%), Positives = 49/101 (48%), Gaps = 3/101 (2%) Frame = -2 Query: 436 ITSLDELKTKVGHVIVMILLVKMFERSKMVKITTGLDLLSYSVCIFLSSASLYILHNLHR 257 IT LDE+ +G I ILL ++ ER K + DLL S + L+N + Sbjct: 546 ITLLDEVGVDIGAKISPILLAELGERFKAPDV---FDLLLSDDRKGRKSGKGFYLYNTKK 602 Query: 256 PEHEESVMPHL*LNRASRSS-DAMASWCSCRLVSD--RCID 143 E ++SV L L +++ +A C+ ++++ RC+D Sbjct: 603 KEVDKSVYKLLSLEPEQKAAGQDIALRCTLMMLNEAARCLD 643
>MUTS_CHLPN (Q9Z6W5) DNA mismatch repair protein mutS| Length = 828 Score = 30.0 bits (66), Expect = 7.1 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +3 Query: 597 HINGLDDLEDHLPCMDTFGASSSSRHNRPLFMY 695 H L LEDH P ++ F A + +P+F+Y Sbjct: 740 HYKELTTLEDHCPHVENFHAGVKDKAGQPVFLY 772 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 95,879,093 Number of Sequences: 219361 Number of extensions: 1984839 Number of successful extensions: 6234 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 6006 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6233 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 6969622431 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)