| Clone Name | rbaal3j22 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SYNE2_HUMAN (Q8WXH0) Nesprin-2 (Nuclear envelope spectrin repeat... | 35 | 0.13 | 2 | CAP8_ARATH (Q8LBH2) Putative clathrin assembly protein At2g01600 | 30 | 3.2 | 3 | YC10_KLEPN (Q48456) Hypothetical 49.5 kDa protein in cps region ... | 29 | 7.1 | 4 | EMI2_YEAST (Q04409) Glucokinase EMI2 (EC 2.7.1.2) (Glucose kinas... | 29 | 9.2 |
|---|
>SYNE2_HUMAN (Q8WXH0) Nesprin-2 (Nuclear envelope spectrin repeat protein 2)| (Syne-2) (Synaptic nuclear envelope protein 2) (Nucleus and actin connecting element protein) (NUANCE protein) Length = 6885 Score = 35.0 bits (79), Expect = 0.13 Identities = 22/74 (29%), Positives = 36/74 (48%) Frame = +1 Query: 112 IYWIH*APNLAKRIAHVQDLEASPKATLPSITQDMQASYLVKNHSYHVDIVQSVLQKPII 291 + W+ A N ++ AHV D +A P+A L + MQ + VD++Q + +I Sbjct: 6674 LLWLASAKNRRQK-AHVTDPKADPRALLECRRELMQLEKELVERQPQVDMLQEISNSLLI 6732 Query: 292 SGYKEENINQESNV 333 G+ E+ I E V Sbjct: 6733 KGHGEDCIEAEEKV 6746
>CAP8_ARATH (Q8LBH2) Putative clathrin assembly protein At2g01600| Length = 571 Score = 30.4 bits (67), Expect = 3.2 Identities = 13/31 (41%), Positives = 21/31 (67%) Frame = +1 Query: 262 VQSVLQKPIISGYKEENINQESNVFQNDGLL 354 V V Q+P SGY + ++NQ +N F++ GL+ Sbjct: 541 VNPVSQQPNTSGYGDFSVNQHNNPFRSTGLI 571
>YC10_KLEPN (Q48456) Hypothetical 49.5 kDa protein in cps region (ORF10)| Length = 429 Score = 29.3 bits (64), Expect = 7.1 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -1 Query: 324 FLIYVFFFIARYYRFLQN 271 FL+YVF+F+A YY QN Sbjct: 116 FLLYVFYFLALYYSLRQN 133
>EMI2_YEAST (Q04409) Glucokinase EMI2 (EC 2.7.1.2) (Glucose kinase) (GLK)| (Early meiotic induction protein 2) Length = 500 Score = 28.9 bits (63), Expect = 9.2 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = -1 Query: 279 LQN*LHDVHVVGMVLNQIRGLHVLCDRRKCGLRRCLEIL 163 L+N L D+H G++L Q R L R K + C E+L Sbjct: 335 LRNILVDLHARGLILGQYRNYDQLPHRLKTPFQLCSEVL 373 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 73,214,155 Number of Sequences: 219361 Number of extensions: 1444015 Number of successful extensions: 3202 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3142 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3202 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4085413911 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)