| Clone Name | rbaal3i17 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LPXK_CAUCR (P58184) Tetraacyldisaccharide 4'-kinase (EC 2.7.1.13... | 29 | 9.0 |
|---|
>LPXK_CAUCR (P58184) Tetraacyldisaccharide 4'-kinase (EC 2.7.1.130) (Lipid A| 4'-kinase) Length = 335 Score = 28.9 bits (63), Expect = 9.0 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = +2 Query: 227 TTHNEWPFVQAKVFPAFRCGQA*NWNLLGRDLVILAMPYD 346 T EWPF +VFPA + L D VI+ +P D Sbjct: 167 TRGGEWPFGDGRVFPAGPMREPLKVGLSRADAVIVLLPVD 206 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 65,533,694 Number of Sequences: 219361 Number of extensions: 1187581 Number of successful extensions: 2944 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 2859 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2944 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3985467738 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)