| Clone Name | rbaal3i11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | HMEN_ARTSF (Q05640) Homeobox protein engrailed | 28 | 5.2 | 2 | INADL_MOUSE (Q63ZW7) InaD-like protein (Inadl protein) (Pals1-as... | 28 | 5.2 |
|---|
>HMEN_ARTSF (Q05640) Homeobox protein engrailed| Length = 349 Score = 28.5 bits (62), Expect = 5.2 Identities = 15/49 (30%), Positives = 25/49 (51%), Gaps = 2/49 (4%) Frame = -3 Query: 152 SDLIQRFHSPLPLS--APSPFKNQPISRAMSQTVELRVGMSCEGCVGAV 12 S+L +R+ P PLS P P ++P S MS + G+S + + + Sbjct: 19 SNLTERYDGPSPLSASTPGPSPDRPGSATMSSPLSSPTGISYQSLLSGI 67
>INADL_MOUSE (Q63ZW7) InaD-like protein (Inadl protein) (Pals1-associated tight| junction protein) (Protein associated to tight junctions) (Channel-interacting PDZ domain-containing protein) Length = 1834 Score = 28.5 bits (62), Expect = 5.2 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = -3 Query: 155 PSDLIQRFHSPLPLSAPSPFKNQPISRAMSQTVELRVGMSCE 30 P+D + HS L L AP F+++P + L +G S + Sbjct: 797 PADAVHEIHSSLILEAPQGFRDEPYLEELVDEPFLDLGKSLQ 838 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 16,308,048 Number of Sequences: 219361 Number of extensions: 196411 Number of successful extensions: 927 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 916 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 926 length of database: 80,573,946 effective HSP length: 29 effective length of database: 74,212,477 effective search space used: 1781099448 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)