| Clone Name | rbaal3h24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FLIK_ECOLI (P52614) Flagellar hook-length control protein | 32 | 1.3 | 2 | AXHA_ASPTU (P79021) Alpha-L-arabinofuranosidase precursor (EC 3.... | 30 | 6.2 | 3 | PRP5_ASPOR (Q2U2J6) Pre-mRNA-processing ATP-dependent RNA helica... | 29 | 8.1 |
|---|
>FLIK_ECOLI (P52614) Flagellar hook-length control protein| Length = 375 Score = 32.0 bits (71), Expect = 1.3 Identities = 19/59 (32%), Positives = 29/59 (49%), Gaps = 2/59 (3%) Frame = -2 Query: 464 STVVPTDLATAF--VTGNEWSVLSGDPRPATPTNLLTPTSAANQSMKD*TCLPAEMLSS 294 STV+PT+ T F +T + + D P TP LTP A QS + P+ + ++ Sbjct: 152 STVLPTEKPTLFTKLTSEQLTTAQPDDAPGTPAQPLTPLVAEAQSKAEVISTPSPVTAA 210
>AXHA_ASPTU (P79021) Alpha-L-arabinofuranosidase precursor (EC 3.2.1.55)| (Arabinoxylan arabinofuranohydrolase) Length = 332 Score = 29.6 bits (65), Expect = 6.2 Identities = 20/66 (30%), Positives = 29/66 (43%) Frame = -2 Query: 551 TNKSTDSGTKDFATNVEPGGGKHFFAVKSSTVVPTDLATAFVTGNEWSVLSGDPRPATPT 372 T KS + KDF V G KH ++ + F +EWS ++ + ATP Sbjct: 44 TPKSGWTALKDFTDVVSDG--KHIVYASTTDEAGNYGSMTFGAFSEWSNMASASQTATPF 101 Query: 371 NLLTPT 354 N + PT Sbjct: 102 NAVAPT 107
>PRP5_ASPOR (Q2U2J6) Pre-mRNA-processing ATP-dependent RNA helicase prp5 (EC| 3.6.1.-) Length = 1186 Score = 29.3 bits (64), Expect = 8.1 Identities = 24/68 (35%), Positives = 35/68 (51%), Gaps = 2/68 (2%) Frame = +2 Query: 221 ASRTRTGFPSTLANVSKTKPRSS*TN*ASQLAGKFNLSCFGLQLK*A--SANLSEWQALG 394 +++T FPST V KP S+ ++ AS L K N+ FGL K A + S + LG Sbjct: 271 SAKTSATFPSTKTEVQANKP-SATSSKASSLKVKGNVGSFGLGTKQAADTEKASATKTLG 329 Query: 395 HH*GQTTR 418 ++TR Sbjct: 330 FGEEESTR 337 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 77,885,562 Number of Sequences: 219361 Number of extensions: 1561625 Number of successful extensions: 4307 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4175 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4305 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4700377760 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)