| Clone Name | rbaal3f24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YB79_YEAST (P38138) Putative family 31 glucosidase in FAT2-PBP2 ... | 32 | 1.6 | 2 | MAST3_HUMAN (O60307) Microtubule-associated serine/threonine-pro... | 30 | 6.1 | 3 | CALCA_CHICK (P10286) Calcitonin gene-related peptide precursor (... | 29 | 8.0 | 4 | RLUD_YERPE (Q8ZBV7) Ribosomal large subunit pseudouridine syntha... | 29 | 8.0 |
|---|
>YB79_YEAST (P38138) Putative family 31 glucosidase in FAT2-PBP2 intergenic| region (EC 3.2.1.-) Length = 954 Score = 31.6 bits (70), Expect = 1.6 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = +1 Query: 73 IYLECAYMLIKKYFTWTTHYYPDTLRL 153 I+L+ Y KKYFTW H +P+ RL Sbjct: 422 IWLDLEYTNDKKYFTWKQHSFPNPKRL 448
>MAST3_HUMAN (O60307) Microtubule-associated serine/threonine-protein kinase 3 (EC| 2.7.11.1) Length = 1309 Score = 29.6 bits (65), Expect = 6.1 Identities = 22/44 (50%), Positives = 25/44 (56%) Frame = +1 Query: 427 QSSSEALHTVPLSSSLHL*WNPWPRTAAPRPSPTGPARSPAPRV 558 +S S LH LSSS L +P T + PSPT P RSPAP V Sbjct: 1090 RSFSSGLHH-SLSSSESLPGSP---THSLSPSPTTPCRSPAPDV 1129
>CALCA_CHICK (P10286) Calcitonin gene-related peptide precursor (CGRP)| Length = 125 Score = 29.3 bits (64), Expect = 8.0 Identities = 28/90 (31%), Positives = 33/90 (36%) Frame = -3 Query: 490 DSIKDEGRMTREQYAALRRKIGGTYKDFFKSXXXXXXXXXXXXXXDKTCKVCKKDTRGEP 311 +SI D R+T Y A RR + KDF + + C T Sbjct: 33 ESITD--RVTLSDYEA-RRLLNALVKDFIQMTAEELEQASEGNSVTAQKRACNTATCVTH 89 Query: 310 RQVDNLGRYMHVACAENSKPTNFFSKLFGR 221 R D L R V N PTN SK FGR Sbjct: 90 RLADFLSRSGGVG-KNNFVPTNVGSKAFGR 118
>RLUD_YERPE (Q8ZBV7) Ribosomal large subunit pseudouridine synthase D (EC| 5.4.99.-) (rRNA-uridine isomerase D) (rRNA pseudouridylate synthase D) Length = 325 Score = 29.3 bits (64), Expect = 8.0 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +1 Query: 127 HYYPDTLRLQHASIYLTMSRTTSGLMVQKKFI 222 HYYP+ + + A I + + T+GLMV K + Sbjct: 121 HYYPEIMDVPRAGIVHRLDKDTTGLMVVAKTV 152 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 78,771,020 Number of Sequences: 219361 Number of extensions: 1661222 Number of successful extensions: 5427 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4946 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5402 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4643056080 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)