| Clone Name | rbaal3f01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | ATPG_MYCTU (P63671) ATP synthase gamma chain (EC 3.6.3.14) (ATP ... | 29 | 6.6 | 2 | ATPG_MYCBO (P63672) ATP synthase gamma chain (EC 3.6.3.14) (ATP ... | 29 | 6.6 | 3 | YEK9_SCHPO (O36021) Hypothetical protein C4F10.09c in chromosome I | 29 | 6.6 | 4 | PIP1_DROME (P25455) 1-phosphatidylinositol-4,5-bisphosphate phos... | 28 | 8.6 |
|---|
>ATPG_MYCTU (P63671) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 305 Score = 28.9 bits (63), Expect = 6.6 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -3 Query: 417 HRLCPMVPTHAKEEIASSTLMSPEADSKM 331 HR+ PMV + +E+I TL S E D+ M Sbjct: 200 HRIAPMVVEYVEEDIGPRTLYSFEPDATM 228
>ATPG_MYCBO (P63672) ATP synthase gamma chain (EC 3.6.3.14) (ATP synthase F1| sector gamma subunit) Length = 305 Score = 28.9 bits (63), Expect = 6.6 Identities = 13/29 (44%), Positives = 18/29 (62%) Frame = -3 Query: 417 HRLCPMVPTHAKEEIASSTLMSPEADSKM 331 HR+ PMV + +E+I TL S E D+ M Sbjct: 200 HRIAPMVVEYVEEDIGPRTLYSFEPDATM 228
>YEK9_SCHPO (O36021) Hypothetical protein C4F10.09c in chromosome I| Length = 860 Score = 28.9 bits (63), Expect = 6.6 Identities = 12/48 (25%), Positives = 26/48 (54%) Frame = +1 Query: 88 TCI*EPRKYRSRYHSDVTLVSSYVLYGERRTIQAKIKMQIQNHILLPF 231 +C+ E + + +H V+L++ ++YGE+ + + + NH L F Sbjct: 588 SCLWEIHPFLNHFHPTVSLLAKSLVYGEKILGKPNLSLHTLNHFLDKF 635
>PIP1_DROME (P25455) 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase| classes I and II (EC 3.1.4.11) (Phosphoinositide phospholipase C) Length = 1312 Score = 28.5 bits (62), Expect = 8.6 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -3 Query: 387 AKEEIASSTLMSPEADSKMPGTTPGAPSGDQ 295 +K+ SS S D +P TTP PSG++ Sbjct: 553 SKDSTGSSDSDSSSEDESLPNTTPNLPSGNE 583 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 68,873,331 Number of Sequences: 219361 Number of extensions: 1432136 Number of successful extensions: 3519 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3447 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3519 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2909956200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)