| Clone Name | rbaal2p15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RIN4_ARATH (Q8GYN5) RPM1-interacting protein 4 | 53 | 4e-07 | 2 | TRP_DROME (P19334) Transient receptor potential protein | 33 | 0.62 | 3 | CARA_SULSO (Q59968) Carbamoyl-phosphate synthase small chain (EC... | 30 | 3.1 | 4 | WWOX_PONPY (Q5R9W5) WW domain-containing oxidoreductase (EC 1.1.... | 29 | 6.9 | 5 | WWOX_HUMAN (Q9NZC7) WW domain-containing oxidoreductase (EC 1.1.... | 29 | 9.0 |
|---|
>RIN4_ARATH (Q8GYN5) RPM1-interacting protein 4| Length = 211 Score = 53.1 bits (126), Expect = 4e-07 Identities = 22/39 (56%), Positives = 30/39 (76%) Frame = -2 Query: 423 SEESGRPLPKFGEWDVNDPASADGFTVIFNKARDEKKAG 307 S E +PKFG+WD N+P+SADG+T IFNK R+E+ +G Sbjct: 141 SPEKVTVVPKFGDWDENNPSSADGYTHIFNKVREERSSG 179
>TRP_DROME (P19334) Transient receptor potential protein| Length = 1275 Score = 32.7 bits (73), Expect = 0.62 Identities = 14/38 (36%), Positives = 24/38 (63%) Frame = -2 Query: 381 DVNDPASADGFTVIFNKARDEKKAGNGQDTESPCKDAR 268 +V++ + ADG K D+KKAG+ +D + P KD++ Sbjct: 985 NVDEKSGADGKPGTMGKPTDDKKAGDDKDKQQPPKDSK 1022
>CARA_SULSO (Q59968) Carbamoyl-phosphate synthase small chain (EC 6.3.5.5)| (Carbamoyl-phosphate synthetase glutamine chain) Length = 367 Score = 30.4 bits (67), Expect = 3.1 Identities = 13/34 (38%), Positives = 20/34 (58%) Frame = +1 Query: 256 HPLSPGVFARGFSILSIPSLFLIPGFVEYNCESI 357 H + G++ RGFSI+ +P F +EYN + I Sbjct: 192 HGILYGLYKRGFSIVRVPCSFSASKIIEYNPKGI 225
>WWOX_PONPY (Q5R9W5) WW domain-containing oxidoreductase (EC 1.1.1.-)| Length = 414 Score = 29.3 bits (64), Expect = 6.9 Identities = 21/69 (30%), Positives = 33/69 (47%) Frame = +1 Query: 283 RGFSILSIPSLFLIPGFVEYNCESISRSWVVDVPFAKLGQRATRFLRHGLSAAAVRSAEG 462 R S + S + PG + Y+ +I RSW V L + T+ ++ G + +A Sbjct: 309 RRLSPRGVTSNAVHPGNMMYS--NIHRSWWVYTLLFTLARPFTKSMQQGAATTVYCAAAP 366 Query: 463 EGEGLGGKF 489 E EGLGG + Sbjct: 367 ELEGLGGMY 375
>WWOX_HUMAN (Q9NZC7) WW domain-containing oxidoreductase (EC 1.1.1.-) (Fragile| site FRA16D oxidoreductase) Length = 414 Score = 28.9 bits (63), Expect = 9.0 Identities = 21/69 (30%), Positives = 33/69 (47%) Frame = +1 Query: 283 RGFSILSIPSLFLIPGFVEYNCESISRSWVVDVPFAKLGQRATRFLRHGLSAAAVRSAEG 462 R S + S + PG + Y+ +I RSW V L + T+ ++ G + +A Sbjct: 309 RRLSPRGVTSNAVHPGNMMYS--NIHRSWWVYTLLFTLARPFTKSMQQGAATTVYCAAVP 366 Query: 463 EGEGLGGKF 489 E EGLGG + Sbjct: 367 ELEGLGGMY 375 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 86,070,076 Number of Sequences: 219361 Number of extensions: 1908980 Number of successful extensions: 5215 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5072 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5215 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3985467738 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)