| Clone Name | rbaal3e17 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PTPA_RABIT (Q28717) Serine/threonine-protein phosphatase 2A regu... | 30 | 4.3 | 2 | RPN7_YEAST (Q06103) 26S proteasome regulatory subunit RPN7 | 29 | 9.6 | 3 | ZN694_HUMAN (Q63HK3) Zinc finger protein 694 | 29 | 9.6 | 4 | ZN418_HUMAN (Q8TF45) Zinc finger protein 418 | 29 | 9.6 |
|---|
>PTPA_RABIT (Q28717) Serine/threonine-protein phosphatase 2A regulatory subunit| B' (PP2A, subunit B', PR53 isoform) (Phosphotyrosyl phosphatase activator) (PTPA) Length = 323 Score = 30.0 bits (66), Expect = 4.3 Identities = 24/102 (23%), Positives = 44/102 (43%), Gaps = 16/102 (15%) Frame = -1 Query: 375 KWMREGPPLGDKHGRFRRR----------------LGALVHCFTEAALPIVDT*LHHLVG 244 +W+ E PP+ D+ RF + + A+V AA+P V L VG Sbjct: 86 RWIDETPPV-DQPSRFGNKAYRTWYAKLDEEAEGLVAAVVPAHLAAAVPEVAVYLKESVG 144 Query: 243 QQVRIWQKTAHVVSYS*IVSLLQRCQKLQTEDSLVGLLELFS 118 RI T H +++ + L + L+ +D + + ++F+ Sbjct: 145 NSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFN 186
>RPN7_YEAST (Q06103) 26S proteasome regulatory subunit RPN7| Length = 429 Score = 28.9 bits (63), Expect = 9.6 Identities = 31/117 (26%), Positives = 53/117 (45%), Gaps = 7/117 (5%) Frame = -1 Query: 348 GDKHGRFRRRLGALVHC-----FTEAALPIVDT*LHHLVGQQVRIWQKTAHVVSYS*IVS 184 GD R R + +HC F EAA +VD+ L ++ ++ A S + + + Sbjct: 202 GDWERRNRYKTYYGIHCLAVRNFKEAAKLLVDS-LATFTSIELTSYESIATYASVTGLFT 260 Query: 183 LLQRCQKLQTEDS--LVGLLELFSLVQGVVAIPYIHYFVLYANNFILLCSTYVIVLL 19 L + K + DS L+ L+ + +Q + ++ Y YA+ F L TY VL+ Sbjct: 261 LERTDLKSKVIDSPELLSLISTTAALQSISSLTISLYASDYASYFPYLLETYANVLI 317
>ZN694_HUMAN (Q63HK3) Zinc finger protein 694| Length = 967 Score = 28.9 bits (63), Expect = 9.6 Identities = 13/36 (36%), Positives = 18/36 (50%) Frame = -3 Query: 217 CSCCFLQLNSLIVTAMPKTSNRGFPCGPVGTFFSCS 110 C CF Q +SLI+ T + + CG G F+ S Sbjct: 836 CGKCFSQSSSLIIHQRTHTGEKPYQCGECGKSFTNS 871
>ZN418_HUMAN (Q8TF45) Zinc finger protein 418| Length = 676 Score = 28.9 bits (63), Expect = 9.6 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -3 Query: 223 ENCSCCFLQLNSLIVTAMPKTSNRGFPCGPVGTFFSCSG 107 E C CF Q +LI TS R + C G FS G Sbjct: 345 EECGKCFTQKGNLIQHQRGHTSERPYECEECGKCFSQKG 383 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 82,510,097 Number of Sequences: 219361 Number of extensions: 1754982 Number of successful extensions: 4734 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4538 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4720 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4258037034 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)