| Clone Name | rbaak18b09 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | EXTN_DAUCA (P06599) Extensin precursor | 32 | 2.1 | 2 | FUT3_BOVIN (Q11126) Galactoside 3(4)-L-fucosyltransferase (EC 2.... | 31 | 2.7 |
|---|
>EXTN_DAUCA (P06599) Extensin precursor| Length = 306 Score = 31.6 bits (70), Expect = 2.1 Identities = 14/38 (36%), Positives = 23/38 (60%), Gaps = 2/38 (5%) Frame = +3 Query: 477 YRSPPYPHHSL--LYRLHFLNLIHPRPLHRSPPCPNHA 584 Y+SPP P HS ++ + + P P+++SPP P H+ Sbjct: 205 YKSPPPPKHSPAPVHHYKYKSPPPPTPVYKSPPPPEHS 242
>FUT3_BOVIN (Q11126) Galactoside 3(4)-L-fucosyltransferase (EC 2.4.1.65) (Blood| group Lewis alpha-4-fucosyltransferase) (Lewis FT) (Fucosyltransferase 3) (FUCT-III) (FUTB) Length = 365 Score = 31.2 bits (69), Expect = 2.7 Identities = 25/69 (36%), Positives = 35/69 (50%), Gaps = 6/69 (8%) Frame = +3 Query: 42 LQERAIPSVCTDPTKANHES--PNWEAIHLSDLQQPIDVSTFAL----DVASHQTYTGFR 203 LQ A+P V P++ N+E P IH+ D Q P D++ + L D AS+ Y +R Sbjct: 269 LQAWAVP-VVLGPSRVNYEQFLPPKAFIHVEDFQSPKDLAQYLLALDKDYASYLNYFRWR 327 Query: 204 PGLST*RPR 230 T RPR Sbjct: 328 ---ETLRPR 333 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 83,510,209 Number of Sequences: 219361 Number of extensions: 1554371 Number of successful extensions: 4077 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3968 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4073 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 5972710590 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)