| Clone Name | rbaal3e05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | DCG1_YEAST (P32460) Protein DCG1 | 30 | 5.3 | 2 | TOP2_LEICH (O61078) DNA topoisomerase 2 (EC 5.99.1.3) (DNA topoi... | 29 | 9.1 |
|---|
>DCG1_YEAST (P32460) Protein DCG1| Length = 244 Score = 29.6 bits (65), Expect = 5.3 Identities = 17/58 (29%), Positives = 31/58 (53%) Frame = -3 Query: 369 TNSVTVMLLYSLVFTLSP*ECKLASFSNRRRNETQVDMKE*HLKQRNKCLMM*FVEDQ 196 + S+TV L ++ T S CK++ F+ + Q+D +E +K CL + ++DQ Sbjct: 13 SKSMTVSLRETIEKTFSMESCKISYFTGPDTSPPQIDGQETSIKSMEACLPL-LIDDQ 69
>TOP2_LEICH (O61078) DNA topoisomerase 2 (EC 5.99.1.3) (DNA topoisomerase II)| Length = 1236 Score = 28.9 bits (63), Expect = 9.1 Identities = 19/57 (33%), Positives = 30/57 (52%), Gaps = 3/57 (5%) Frame = -2 Query: 412 PFCLVKIINGITSQNKFCHCNAA---IFSCFYSFSLRM*ACKFQQ*KKKRDSSRYER 251 P +V ++NG+ + N HCNAA + SC S S F++ K D++R +R Sbjct: 285 PKRIVGVVNGVVTYNGGTHCNAAMDILDSCLDSLSK-----NFKKNGKVVDTNRVQR 336 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,359,930 Number of Sequences: 219361 Number of extensions: 1140726 Number of successful extensions: 2309 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2281 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2309 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4027872870 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)