| Clone Name | rbaal3e04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FP1_MYTED (Q25460) Adhesive plaque matrix protein (Polyphenolic ... | 31 | 3.6 | 2 | RAF1_XENLA (P09560) RAF proto-oncogene serine/threonine-protein ... | 31 | 3.6 | 3 | MSL2_DROME (P50534) Protein male-specific lethal-2 | 30 | 8.0 |
|---|
>FP1_MYTED (Q25460) Adhesive plaque matrix protein (Polyphenolic adhesive| protein) (Foot protein 1) (MEFP1) (Fragment) Length = 875 Score = 30.8 bits (68), Expect = 3.6 Identities = 21/64 (32%), Positives = 27/64 (42%), Gaps = 1/64 (1%) Frame = +1 Query: 208 PTNRGKPTH*STYVAKCFNA*Q*YILRQRMMHVAKFSTSTKVPP*FR-KRSLPSHTKQNL 384 PT + KPT+ STY AK + A + PP ++ K S PS K Sbjct: 453 PTYKAKPTYPSTYKAK-------------PSYPASYKAKPSYPPTYKSKSSYPSSYKPKK 499 Query: 385 LYPP 396 YPP Sbjct: 500 TYPP 503 Score = 30.0 bits (66), Expect = 6.1 Identities = 21/67 (31%), Positives = 32/67 (47%), Gaps = 4/67 (5%) Frame = +1 Query: 208 PTNRGKPTH*STYVAK-CFNA*Q*Y--ILRQRMMHVAKFSTSTKVPP*FRKRSL-PSHTK 375 PT + KPT+ STY AK + A Y + + + + PP ++ +S+ PS K Sbjct: 731 PTYKAKPTYPSTYKAKPTYKAKPTYPPTYKAKPSYPPTYKPKPSYPPTYKSKSIYPSSYK 790 Query: 376 QNLLYPP 396 YPP Sbjct: 791 PKKTYPP 797
>RAF1_XENLA (P09560) RAF proto-oncogene serine/threonine-protein kinase (EC| 2.7.11.1) (C-RAF) Length = 638 Score = 30.8 bits (68), Expect = 3.6 Identities = 19/61 (31%), Positives = 29/61 (47%) Frame = +2 Query: 218 VENLLTNQRTSQNVLTLDSNIFSGNG*CMSPNLAHQQKSHLDSERDPCLRTPSKISSTHR 397 +E++ +T N ++F G+ CMSP + HQ + D L SK SST R Sbjct: 1 MEHIQGAWKTLSNGFGFKESVFEGSS-CMSPTIVHQFGYQRRASDDGKLSDTSKTSSTMR 59 Query: 398 I 400 + Sbjct: 60 V 60
>MSL2_DROME (P50534) Protein male-specific lethal-2| Length = 773 Score = 29.6 bits (65), Expect = 8.0 Identities = 17/52 (32%), Positives = 21/52 (40%) Frame = +3 Query: 63 RCLSRLSMRQNNTCTHVDVPAFRVPRPNPGPSCGSCHCMCLKLPRLEHTDES 218 RC S TC + P ++ SC CHC+C K P E ES Sbjct: 526 RCGISGSSNTLTTCRNSRCPCYKSYN-----SCAGCHCVCCKNPHKEDYVES 572 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 100,443,862 Number of Sequences: 219361 Number of extensions: 2189206 Number of successful extensions: 5020 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4795 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5017 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6029593548 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)