| Clone Name | rbaal2o17 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | LDB3_HUMAN (O75112) LIM domain-binding protein 3 (Z-band alterna... | 28 | 7.3 | 2 | Y091_NPVOP (O10341) Hypothetical 29.3 kDa protein (ORF92) | 28 | 9.6 |
|---|
>LDB3_HUMAN (O75112) LIM domain-binding protein 3 (Z-band alternatively spliced| PDZ-motif protein) (Protein cypher) Length = 727 Score = 28.1 bits (61), Expect = 7.3 Identities = 15/31 (48%), Positives = 18/31 (58%) Frame = -1 Query: 93 PVPTYDPSPTPTSCFSPRCHAEKIAPSVYFA 1 PVPTY PSP P SP + APSV ++ Sbjct: 449 PVPTYTPSPAPAYTPSPAPNYNP-APSVAYS 478
>Y091_NPVOP (O10341) Hypothetical 29.3 kDa protein (ORF92)| Length = 279 Score = 27.7 bits (60), Expect = 9.6 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -1 Query: 93 PVPTYDPSPTPTSCFSP 43 P PT PSPTPT SP Sbjct: 63 PTPTPTPSPTPTPALSP 79 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 11,912,575 Number of Sequences: 219361 Number of extensions: 124176 Number of successful extensions: 891 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 586 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 869 length of database: 80,573,946 effective HSP length: 6 effective length of database: 79,257,780 effective search space used: 1902186720 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)