| Clone Name | rbaal3d14 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YI0B_SCHPO (Q9URZ4) Putative amino-acid permease C869.11 | 31 | 3.1 | 2 | SYC_BORBU (O51545) Cysteinyl-tRNA synthetase (EC 6.1.1.16) (Cyst... | 30 | 6.8 | 3 | COAT_TYLCA (P36278) Coat protein (CP) | 30 | 6.8 |
|---|
>YI0B_SCHPO (Q9URZ4) Putative amino-acid permease C869.11| Length = 580 Score = 31.2 bits (69), Expect = 3.1 Identities = 19/48 (39%), Positives = 27/48 (56%) Frame = -3 Query: 414 ACFTSIFLCKIRGFIIINIFRSLIYAVFRFNLLS*KIVHSFGFLIFML 271 A + SIFL I II+N+F Y F L + K+V +FGF+I + Sbjct: 190 AAWISIFLVVI---IIVNLFGVRAYGEVEFILSTVKVVATFGFIILAI 234
>SYC_BORBU (O51545) Cysteinyl-tRNA synthetase (EC 6.1.1.16) (Cysteine--tRNA| ligase) (CysRS) Length = 480 Score = 30.0 bits (66), Expect = 6.8 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -1 Query: 302 YIPLDFSFLCLHSSNKNWMDFVLTNL 225 + PLDF +LCL S +N + F L NL Sbjct: 297 FSPLDFRYLCLTSHYRNQLKFSLDNL 322
>COAT_TYLCA (P36278) Coat protein (CP)| Length = 256 Score = 30.0 bits (66), Expect = 6.8 Identities = 19/65 (29%), Positives = 29/65 (44%), Gaps = 9/65 (13%) Frame = +1 Query: 358 NIYDNESSNLTKKNGSEAGNQLTERCSTFTSQN---------ISTFYNLILQ*AFCTYQH 510 N+YDNE S T KN G Q+ ++ S + I+ FY + CTY H Sbjct: 157 NMYDNEPSTATVKNDMRDGFQVIKKWSATVTGGQYASKEQAIINRFYKIY---NHCTYNH 213 Query: 511 EHKSE 525 + ++ Sbjct: 214 QEAAK 218 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 90,756,470 Number of Sequences: 219361 Number of extensions: 1733328 Number of successful extensions: 3586 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3507 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3586 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6712189044 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)