| Clone Name | rbaal3d07 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NU5M_MYXGL (Q9G2W8) NADH-ubiquinone oxidoreductase chain 5 (EC 1... | 30 | 4.9 |
|---|
>NU5M_MYXGL (Q9G2W8) NADH-ubiquinone oxidoreductase chain 5 (EC 1.6.5.3) (NADH| dehydrogenase subunit 5) Length = 601 Score = 30.4 bits (67), Expect = 4.9 Identities = 26/73 (35%), Positives = 37/73 (50%), Gaps = 1/73 (1%) Frame = +1 Query: 298 NLRTFYIHQSNSSSGWT*IVS*DLAGRYQLGKH-QFQIANYIISHPCKYLLSVRETPVPD 474 N++ +I Q+NS W ++ LA GK QF + HP +LLS E P P Sbjct: 194 NMKQIFILQNNSMDLWLPLLGIVLAAT---GKSAQFML------HP--WLLSAMEGPTPV 242 Query: 475 SKLYYLSSM*ISG 513 S L + S+M +SG Sbjct: 243 SALLHSSTMVVSG 255 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 95,643,881 Number of Sequences: 219361 Number of extensions: 1911720 Number of successful extensions: 4348 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4174 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4342 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6314008338 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)