| Clone Name | rbaal2n04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SRBP1_RAT (P56720) Sterol regulatory element-binding protein 1 (... | 31 | 3.3 | 2 | OL145_MOUSE (Q60882) Olfactory receptor 145 (Olfactory receptor ... | 31 | 3.3 | 3 | YFF9_SCHPO (O14066) Hypothetical serine-rich protein C1687.09 in... | 31 | 4.4 | 4 | UBP40_MOUSE (Q8BWR4) Ubiquitin carboxyl-terminal hydrolase 40 (E... | 30 | 9.7 |
|---|
>SRBP1_RAT (P56720) Sterol regulatory element-binding protein 1 (SREBP-1)| (Sterol regulatory element-binding transcription factor 1) (Adipocyte determination- and differentiation-dependent factor 1) (ADD1) (Fragment) Length = 1024 Score = 31.2 bits (69), Expect = 3.3 Identities = 19/68 (27%), Positives = 31/68 (45%) Frame = -1 Query: 657 AAFLGYSLILAILRTSKSKGRSFKGDGCSSNSGFCDDPTFCTSTSTNLTKAST*KVCTVI 478 AA + A+L K + C SG+ D TST++++ KA +C ++ Sbjct: 881 AALYSFKAARALLDHRKVESSPASLAICEKASGYLRDSLASTSTASSIDKAMQLLLCDLL 940 Query: 477 SVAQLLLW 454 VA+ LW Sbjct: 941 LVARTSLW 948
>OL145_MOUSE (Q60882) Olfactory receptor 145 (Olfactory receptor 7C) (Olfactory| receptor 161-6) (Odorant receptor K21) Length = 310 Score = 31.2 bits (69), Expect = 3.3 Identities = 20/51 (39%), Positives = 31/51 (60%), Gaps = 1/51 (1%) Frame = -1 Query: 714 HEVTVVILLGQKSCTCPSAAAFLGYSLILA-ILRTSKSKGRSFKGDGCSSN 565 +E+ V I++G P+ F+ Y+LIL+ ILR S ++GRS CSS+ Sbjct: 194 NELVVFIVVGI-DIGVPTVTIFISYALILSSILRISSTEGRSKAFSTCSSH 243
>YFF9_SCHPO (O14066) Hypothetical serine-rich protein C1687.09 in chromosome I| Length = 1379 Score = 30.8 bits (68), Expect = 4.4 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = +1 Query: 94 NSNSQAKSPKFTWKNSSLHWMSGDKFSQIHHER 192 +++ + S K W +SSLH S + FS IHH + Sbjct: 927 SAHKRIPSNKTEWSSSSLHIPSHNSFSDIHHRK 959
>UBP40_MOUSE (Q8BWR4) Ubiquitin carboxyl-terminal hydrolase 40 (EC 3.1.2.15)| (Ubiquitin thioesterase 40) (Ubiquitin-specific-processing protease 40) (Deubiquitinating enzyme 40) (Fragment) Length = 1140 Score = 29.6 bits (65), Expect = 9.7 Identities = 19/55 (34%), Positives = 24/55 (43%), Gaps = 10/55 (18%) Frame = -2 Query: 374 TWKPMMSLRDGDMLMVTQSASP----------WLSPCRTSGGASPRKMLRCARRQ 240 T K +M +R GD L++T+ P W P R SG R L CA Q Sbjct: 908 TLKELM-IRSGDTLLLTEGKLPPPGHLKMPIWWYQPARLSGHCESRDHLNCAFSQ 961 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 111,217,854 Number of Sequences: 219361 Number of extensions: 2404225 Number of successful extensions: 5674 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5459 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5672 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7366267610 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)